| Index: trunk/extensions/OpenStackManager/OpenStackManager.i18n.php |
| — | — | @@ -16,7 +16,7 @@ |
| 17 | 17 | * @author Sam Reed <reedy@wikimedia.org> |
| 18 | 18 | */ |
| 19 | 19 | $messages['en'] = array( |
| 20 | | - 'openstackmanager-desc' => 'Lets users manage Nova and Swift', |
| | 20 | + 'openstackmanager-desc' => 'Lets users manage Nova and Swift.', |
| 21 | 21 | |
| 22 | 22 | 'openstackmanager' => 'OpenStackManager', |
| 23 | 23 | 'openstackmanager-instance' => 'Manage Instance', |
| — | — | @@ -39,10 +39,10 @@ |
| 40 | 40 | 'openstackmanager-rename' => 'rename', |
| 41 | 41 | 'openstackmanager-actions' => 'Actions', |
| 42 | 42 | 'openstackmanager-notloggedin' => 'Login required', |
| 43 | | - 'openstackmanager-mustbeloggedin' => 'You must be logged in to perform this action', |
| 44 | | - 'openstackmanager-nonovacred' => 'No Nova credentials found for your account', |
| | 43 | + 'openstackmanager-mustbeloggedin' => 'You must be logged in to perform this action.', |
| | 44 | + 'openstackmanager-nonovacred' => 'No Nova credentials found for your account.', |
| 45 | 45 | 'openstackmanager-nonovacred-admincreate' => 'There were no Nova credentials found for your user account. Please ask a Nova administrator to create credentials for you.', |
| 46 | | - 'openstackmanager-noaccount' => 'Your account is not in the project requested', |
| | 46 | + 'openstackmanager-noaccount' => 'Your account is not in the project requested.', |
| 47 | 47 | 'openstackmanager-noaccount2' => 'You can not complete the action requested as your user account is not in the project requested.', |
| 48 | 48 | 'openstackmanager-createdomain' => 'Create Domain', |
| 49 | 49 | |
| — | — | @@ -51,12 +51,12 @@ |
| 52 | 52 | 'openstackmanager-novadomain-domain' => 'Domain', |
| 53 | 53 | 'openstackmanager-novadomain-info' => 'Domain Information', |
| 54 | 54 | |
| 55 | | - 'openstackmanager-createdomainfailed' => 'Failed to create domain', |
| 56 | | - 'openstackmanager-createddomain' => 'Created domain', |
| | 55 | + 'openstackmanager-createdomainfailed' => 'Failed to create domain.', |
| | 56 | + 'openstackmanager-createddomain' => 'Created domain.', |
| 57 | 57 | 'openstackmanager-domainlist' => 'Domain list', |
| 58 | 58 | 'openstackmanager-backdomainlist' => 'Back to domain list', |
| 59 | | - 'openstackmanager-deleteddomain' => 'Successfully deleted domain', |
| 60 | | - 'openstackmanager-failedeletedomain' => 'Failed to delete domain', |
| | 59 | + 'openstackmanager-deleteddomain' => 'Successfully deleted domain.', |
| | 60 | + 'openstackmanager-failedeletedomain' => 'Failed to delete domain.', |
| 61 | 61 | 'openstackmanager-domainname' => 'Domain Name', |
| 62 | 62 | 'openstackmanager-fqdn' => 'Fully Qualified Domain Name', |
| 63 | 63 | 'openstackmanager-location' => 'Location', |
| — | — | @@ -82,17 +82,17 @@ |
| 83 | 83 | 'openstackmanager-imagetype' => 'Image Type', |
| 84 | 84 | |
| 85 | 85 | 'openstackmanager-createinstance' => 'Create a new instance', |
| 86 | | - 'openstackmanager-invaliddomain' => 'Requested domain is invalid', |
| | 86 | + 'openstackmanager-invaliddomain' => 'Requested domain is invalid.', |
| 87 | 87 | |
| 88 | | - 'openstackmanager-createdinstance' => 'Created instance $1 with image $2 and hostname $3', |
| 89 | | - 'openstackmanager-createfailedldap' => 'Failed to create instance as the host could not be added to LDAP', |
| 90 | | - 'openstackmanager-createinstancefailed' => 'Failed to create instance', |
| | 88 | + 'openstackmanager-createdinstance' => 'Created instance $1 with image $2 and hostname $3.', |
| | 89 | + 'openstackmanager-createfailedldap' => 'Failed to create instance as the host could not be added to LDAP.', |
| | 90 | + 'openstackmanager-createinstancefailed' => 'Failed to create instance.', |
| 91 | 91 | 'openstackmanager-backinstancelist' => 'Back to instance list', |
| 92 | 92 | 'openstackmanager-deletedinstance' => 'Deleted instance $1', |
| 93 | | - 'openstackmanager-deletedinstance-faileddns' => 'Successfully deleted instance, but failed to remove $1 DNS entry', |
| 94 | | - 'openstackmanager-modifiedinstance' => 'Successfully modified instance', |
| 95 | | - 'openstackmanager-modifyinstancefailed' => 'Failed to modify instance', |
| 96 | | - 'openstackmanager-deleteinstancefailed' => 'Failed to delete instance', |
| | 93 | + 'openstackmanager-deletedinstance-faileddns' => 'Successfully deleted instance, but failed to remove $1 DNS entry.', |
| | 94 | + 'openstackmanager-modifiedinstance' => 'Successfully modified instance.', |
| | 95 | + 'openstackmanager-modifyinstancefailed' => 'Failed to modify instance.', |
| | 96 | + 'openstackmanager-deleteinstancefailed' => 'Failed to delete instance.', |
| 97 | 97 | |
| 98 | 98 | 'openstackmanager-deletekey' => 'Delete key', |
| 99 | 99 | 'openstackmanager-deletekeyconfirm' => 'Are you sure you wish to delete the above key?', |
| — | — | @@ -100,13 +100,13 @@ |
| 101 | 101 | 'openstackmanager-importkey' => 'Import a new key', |
| 102 | 102 | 'openstackmanager-name' => 'Name', |
| 103 | 103 | 'openstackmanager-fingerprint' => 'Fingerprint', |
| 104 | | - 'openstackmanager-invalidkeypair' => 'Invalid keypair location configured', |
| 105 | | - 'openstackmanager-keypairimportfailed' => 'Failed to import keypair', |
| 106 | | - 'openstackmanager-keypairimported' => 'Imported keypair', |
| 107 | | - 'openstackmanager-keypairimportedfingerprint' => 'Imported keypair $1 with fingerprint $2', |
| | 104 | + 'openstackmanager-invalidkeypair' => 'Invalid keypair location configured.', |
| | 105 | + 'openstackmanager-keypairimportfailed' => 'Failed to import keypair.', |
| | 106 | + 'openstackmanager-keypairimported' => 'Imported keypair.', |
| | 107 | + 'openstackmanager-keypairimportedfingerprint' => 'Imported keypair $1 with fingerprint $2.', |
| 108 | 108 | 'openstackmanager-backkeylist' => 'Back to key list', |
| 109 | | - 'openstackmanager-deletedkey' => 'Successfully deleted key', |
| 110 | | - 'openstackmanager-deletedkeyfailed' => 'Failed to delete key', |
| | 109 | + 'openstackmanager-deletedkey' => 'Successfully deleted key.', |
| | 110 | + 'openstackmanager-deletedkeyfailed' => 'Failed to delete key.', |
| 111 | 111 | |
| 112 | 112 | 'openstackmanager-addmember' => 'Add project member', |
| 113 | 113 | 'openstackmanager-removemember' => 'Remove project member', |
| — | — | @@ -117,23 +117,23 @@ |
| 118 | 118 | 'openstackmanager-members' => 'Members', |
| 119 | 119 | 'openstackmanager-member' => 'Member', |
| 120 | 120 | 'openstackmanager-action' => 'Action', |
| 121 | | - 'openstackmanager-createprojectfailed' => 'Failed to create project', |
| 122 | | - 'openstackmanager-createdproject' => 'Created project', |
| | 121 | + 'openstackmanager-createprojectfailed' => 'Failed to create project.', |
| | 122 | + 'openstackmanager-createdproject' => 'Created project.', |
| 123 | 123 | 'openstackmanager-projectlist' => 'Project list', |
| 124 | 124 | 'openstackmanager-backprojectlist' => 'Back to project list', |
| 125 | 125 | 'openstackmanager-deleteproject' => 'Delete project', |
| 126 | | - 'openstackmanager-deletedproject' => 'Successfully deleted project', |
| 127 | | - 'openstackmanager-deleteprojectfailed' => 'Failed to delete project', |
| 128 | | - 'openstackmanager-addedto' => 'Successfully added $1 to $2', |
| 129 | | - 'openstackmanager-failedtoadd' => 'Failed to add $1 to $2', |
| 130 | | - 'openstackmanager-removedfrom' => 'Successfully removed $1 from $2', |
| 131 | | - 'openstackmanager-failedtoremove' => 'Failed to remove $1 from $2', |
| | 126 | + 'openstackmanager-deletedproject' => 'Successfully deleted project.', |
| | 127 | + 'openstackmanager-deleteprojectfailed' => 'Failed to delete project.', |
| | 128 | + 'openstackmanager-addedto' => 'Successfully added $1 to $2.', |
| | 129 | + 'openstackmanager-failedtoadd' => 'Failed to add $1 to $2.', |
| | 130 | + 'openstackmanager-removedfrom' => 'Successfully removed $1 from $2.', |
| | 131 | + 'openstackmanager-failedtoremove' => 'Failed to remove $1 from $2.', |
| 132 | 132 | 'openstackmanager-badinstancename' => 'Bad instance name provided. Instance names must start with a-z, and can only contain a-z, 0-9, and - characters.', |
| 133 | 133 | 'openstackmanager-novaproject-project' => 'Project', |
| 134 | 134 | 'openstackmanager-novaproject-info' => 'Project Information', |
| 135 | 135 | |
| 136 | 136 | 'openstackmanager-shellaccountname' => 'Instance Shell Account Name', |
| 137 | | - 'openstackmanager-shellaccountnamehelp' => 'The shell account name must start with a-z, and can only contain a-z, 0-9, -, and _ characters', |
| | 137 | + 'openstackmanager-shellaccountnamehelp' => 'The shell account name must start with a-z, and can only contain a-z, 0-9, -, and _ characters.', |
| 138 | 138 | |
| 139 | 139 | 'openstackmanager-addresslist' => 'Public IP Address List', |
| 140 | 140 | 'openstackmanager-address' => 'Public IP Address', |
| — | — | @@ -142,32 +142,32 @@ |
| 143 | 143 | 'openstackmanager-associateaddress' => 'Associate IP', |
| 144 | 144 | 'openstackmanager-reassociateaddress' => 'Reassociate IP', |
| 145 | 145 | 'openstackmanager-disassociateaddress' => 'Disassociate IP', |
| 146 | | - 'openstackmanager-allocateaddressfailed' => 'Failed to allocate new public IP address', |
| | 146 | + 'openstackmanager-allocateaddressfailed' => 'Failed to allocate new public IP address.', |
| 147 | 147 | 'openstackmanager-allocatedaddress' => 'Allocated new public IP address: $1', |
| 148 | 148 | 'openstackmanager-backaddresslist' => 'Back to address list', |
| 149 | 149 | 'openstackmanager-allocateaddress-confirm' => 'Are you sure you would like to allocate a new public IP address in project $1?', |
| 150 | 150 | 'openstackmanager-releasedaddress' => 'Successfully released address: $1', |
| 151 | 151 | 'openstackmanager-releaseaddressfailed' => 'Failed to release address: $1', |
| 152 | 152 | 'openstackmanager-cannotreleaseaddress' => 'Cannot release address that has DNS entries or is associated with an instance. Please remove all host entries and disassociate the IP before trying to release it.', |
| 153 | | - 'openstackmanager-associatedaddress' => 'Successfully associated $1 with instance id $2', |
| 154 | | - 'openstackmanager-associateaddressfailed' => 'Failed to associate $1 with instance id $2', |
| 155 | | - 'openstackmanager-disassociatedaddress' => 'Successfully disassociated $1', |
| 156 | | - 'openstackmanager-disassociateaddressfailed' => 'Failed to disassociate $1', |
| | 153 | + 'openstackmanager-associatedaddress' => 'Successfully associated $1 with instance id $2.', |
| | 154 | + 'openstackmanager-associateaddressfailed' => 'Failed to associate $1 with instance id $2.', |
| | 155 | + 'openstackmanager-disassociatedaddress' => 'Successfully disassociated $1.', |
| | 156 | + 'openstackmanager-disassociateaddressfailed' => 'Failed to disassociate $1.', |
| 157 | 157 | 'openstackmanager-disassociateaddress-confirm' => 'Are you sure you would like to disassociate $1?', |
| 158 | 158 | 'openstackmanager-releaseaddress-confirm' => 'Are you sure you would like to release $1?', |
| 159 | 159 | 'openstackmanager-invalidaddress' => '$1 is not a valid allocated IP address.', |
| 160 | 160 | 'openstackmanager-invalidaddressforproject' => '$1 is not in the project requested.', |
| 161 | | - 'openstackmanager-addedhost' => 'Successfully added $1 entry for IP $2', |
| 162 | | - 'openstackmanager-addhostfailed' => 'Failed to add $1 entry for IP $2', |
| | 161 | + 'openstackmanager-addedhost' => 'Successfully added $1 entry for IP $2.', |
| | 162 | + 'openstackmanager-addhostfailed' => 'Failed to add $1 entry for IP $2.', |
| 163 | 163 | 'openstackmanager-hostname' => 'Host Name', |
| 164 | 164 | 'openstackmanager-hostnames' => 'Host Names', |
| 165 | 165 | 'openstackmanager-addhost' => 'Add host name', |
| 166 | 166 | 'openstackmanager-removehost' => 'Remove Host', |
| 167 | 167 | 'openstackmanager-removehost-action' => '(Remove host name)', |
| 168 | 168 | 'openstackmanager-removehost-confirm' => 'Are you sure you would like to remove host $1 from $2?', |
| 169 | | - 'openstackmanager-removedhost' => 'Successfully removed $1', |
| 170 | | - 'openstackmanager-removehostfailed' => 'Failed to remove $1', |
| 171 | | - 'openstackmanager-nonexistenthost' => 'The host requested does not exist', |
| | 169 | + 'openstackmanager-removedhost' => 'Successfully removed $1.', |
| | 170 | + 'openstackmanager-removehostfailed' => 'Failed to remove $1.', |
| | 171 | + 'openstackmanager-nonexistenthost' => 'The host requested does not exist.', |
| 172 | 172 | |
| 173 | 173 | 'openstackmanager-needsysadminrole' => 'Sysadmin Role Required', |
| 174 | 174 | 'openstackmanager-needsysadminrole2' => 'You must be a member of the sysadmin role to perform this action.', |