| Index: trunk/extensions/OpenStackManager/SpecialNovaInstance.php |
| — | — | @@ -1,495 +0,0 @@ |
| 2 | | -<?php |
| 3 | | -class SpecialNovaInstance extends SpecialNova { |
| 4 | | - |
| 5 | | - var $adminNova, $userNova; |
| 6 | | - var $userLDAP; |
| 7 | | - |
| 8 | | - function __construct() { |
| 9 | | - parent::__construct( 'NovaInstance' ); |
| 10 | | - } |
| 11 | | - |
| 12 | | - function execute( $par ) { |
| 13 | | - global $wgRequest, $wgUser; |
| 14 | | - global $wgOpenStackManagerNovaAdminKeys; |
| 15 | | - |
| 16 | | - if ( ! $wgUser->isLoggedIn() ) { |
| 17 | | - $this->notLoggedIn(); |
| 18 | | - return true; |
| 19 | | - } |
| 20 | | - $user = new OpenStackNovaUser(); |
| 21 | | - if ( ! $user->exists() ) { |
| 22 | | - $this->noCredentials(); |
| 23 | | - return true; |
| 24 | | - } |
| 25 | | - $this->userLDAP = new OpenStackNovaUser(); |
| 26 | | - $project = $wgRequest->getVal( 'project' ); |
| 27 | | - $userCredentials = $user->getCredentials( $project ); |
| 28 | | - $this->userNova = new OpenStackNovaController( $userCredentials ); |
| 29 | | - $adminCredentials = $wgOpenStackManagerNovaAdminKeys; |
| 30 | | - $this->adminNova = new OpenStackNovaController( $adminCredentials ); |
| 31 | | - |
| 32 | | - $action = $wgRequest->getVal( 'action' ); |
| 33 | | - |
| 34 | | - if ( $action == "create" ) { |
| 35 | | - if ( ! $user->inProject( $project ) ) { |
| 36 | | - $this->notInProject(); |
| 37 | | - return true; |
| 38 | | - } |
| 39 | | - $this->createInstance(); |
| 40 | | - } else if ( $action == "delete" ) { |
| 41 | | - if ( ! $user->inProject( $project ) ) { |
| 42 | | - $this->notInProject(); |
| 43 | | - return true; |
| 44 | | - } |
| 45 | | - $this->deleteInstance(); |
| 46 | | - } else if ( $action == "rename" ) { |
| 47 | | - if ( ! $user->inProject( $project ) ) { |
| 48 | | - $this->notInProject(); |
| 49 | | - return true; |
| 50 | | - } |
| 51 | | - $this->renameInstance(); |
| 52 | | - } else if ( $action == "configure" ) { |
| 53 | | - if ( ! $user->inProject( $project ) ) { |
| 54 | | - $this->notInProject(); |
| 55 | | - return true; |
| 56 | | - } |
| 57 | | - $this->configureInstance(); |
| 58 | | - } else { |
| 59 | | - $this->listInstances(); |
| 60 | | - } |
| 61 | | - } |
| 62 | | - |
| 63 | | - function createInstance() { |
| 64 | | - global $wgRequest, $wgOut; |
| 65 | | - global $wgOpenStackManagerPuppetOptions; |
| 66 | | - |
| 67 | | - $this->setHeaders(); |
| 68 | | - $wgOut->setPagetitle( wfMsg( 'openstackmanager-createinstance' ) ); |
| 69 | | - |
| 70 | | - $instanceInfo = Array(); |
| 71 | | - $instanceInfo['instancename'] = array( |
| 72 | | - 'type' => 'text', |
| 73 | | - 'label-message' => 'openstackmanager-instancename', |
| 74 | | - 'validation-callback' => array( $this, 'validateInstanceName' ), |
| 75 | | - 'default' => '', |
| 76 | | - 'section' => 'instance/info', |
| 77 | | - ); |
| 78 | | - |
| 79 | | - $instanceTypes = $this->adminNova->getInstanceTypes(); |
| 80 | | - $instanceType_keys = Array(); |
| 81 | | - foreach ( $instanceTypes as $instanceType ) { |
| 82 | | - $instanceType_keys["$instanceType"] = $instanceType; |
| 83 | | - } |
| 84 | | - $instanceInfo['instanceType'] = array( |
| 85 | | - 'type' => 'select', |
| 86 | | - 'label-message' => 'openstackmanager-instancetype', |
| 87 | | - 'section' => 'instance/info', |
| 88 | | - 'options' => $instanceType_keys, |
| 89 | | - ); |
| 90 | | - |
| 91 | | - # Availability zone names can't be translated. Get the keys, and make an array |
| 92 | | - # where the name points to itself as a value |
| 93 | | - $availabilityZones = $this->adminNova->getAvailabilityZones(); |
| 94 | | - $availabilityZone_keys = Array(); |
| 95 | | - foreach ( array_keys( $availabilityZones ) as $availabilityZone_key ) { |
| 96 | | - $availabilityZone_keys["$availabilityZone_key"] = $availabilityZone_key; |
| 97 | | - } |
| 98 | | - $instanceInfo['availabilityZone'] = array( |
| 99 | | - 'type' => 'select', |
| 100 | | - 'section' => 'instance/info', |
| 101 | | - 'options' => $availabilityZone_keys, |
| 102 | | - 'label-message' => 'openstackmanager-availabilityzone', |
| 103 | | - ); |
| 104 | | - |
| 105 | | - # Image names can't be translated. Get the image, and make an array |
| 106 | | - # where the name points to itself as a value |
| 107 | | - $images = $this->adminNova->getImages(); |
| 108 | | - $image_keys = Array(); |
| 109 | | - foreach ( array_keys( $images ) as $image_key ) { |
| 110 | | - $image_keys["$image_key"] = $image_key; |
| 111 | | - } |
| 112 | | - $instanceInfo['imageType'] = array( |
| 113 | | - 'type' => 'select', |
| 114 | | - 'section' => 'instance/info', |
| 115 | | - 'options' => $image_keys, |
| 116 | | - 'label-message' => 'openstackmanager-imagetype', |
| 117 | | - ); |
| 118 | | - |
| 119 | | - # Keypair names can't be translated. Get the keys, and make an array |
| 120 | | - # where the name points to itself as a value |
| 121 | | - # TODO: get keypairs as the user, not the admin |
| 122 | | - # $keypairs = $this->userNova->getKeypairs(); |
| 123 | | - # $keypair_keys = Array(); |
| 124 | | - # foreach ( array_keys( $keypairs ) as $keypair_key ) { |
| 125 | | - # $keypair_keys["$keypair_key"] = $keypair_key; |
| 126 | | - # } |
| 127 | | - # $instanceInfo['keypair'] = array( |
| 128 | | - # 'type' => 'select', |
| 129 | | - # 'section' => 'instance/info', |
| 130 | | - # 'options' => $keypair_keys, |
| 131 | | - # 'label-message' => 'keypair', |
| 132 | | - # ); |
| 133 | | - |
| 134 | | - $domains = OpenStackNovaDomain::getAllDomains( true ); |
| 135 | | - $domain_keys = array(); |
| 136 | | - foreach ( $domains as $domain ) { |
| 137 | | - $domainname = $domain->getDomainName(); |
| 138 | | - $domain_keys["$domainname"] = $domainname; |
| 139 | | - } |
| 140 | | - $instanceInfo['domain'] = array( |
| 141 | | - 'type' => 'select', |
| 142 | | - 'section' => 'instance/info', |
| 143 | | - 'options' => $domain_keys, |
| 144 | | - 'label-message' => 'openstackmanager-dnsdomain', |
| 145 | | - ); |
| 146 | | - |
| 147 | | - $instanceInfo['project'] = array( |
| 148 | | - 'type' => 'hidden', |
| 149 | | - 'default' => $wgRequest->getText( 'project' ), |
| 150 | | - ); |
| 151 | | - |
| 152 | | - if ( $wgOpenStackManagerPuppetOptions['enabled'] ) { |
| 153 | | - if ( $wgOpenStackManagerPuppetOptions['availableclasses'] ) { |
| 154 | | - $classes = array(); |
| 155 | | - foreach ( $wgOpenStackManagerPuppetOptions['availableclasses'] as $class ) { |
| 156 | | - $classes["$class"] = $class; |
| 157 | | - } |
| 158 | | - $instanceInfo['puppetclasses'] = array( |
| 159 | | - 'type' => 'multiselect', |
| 160 | | - 'section' => 'instance/puppetinfo', |
| 161 | | - 'options' => $classes, |
| 162 | | - 'label-message' => 'openstackmanager-puppetclasses', |
| 163 | | - ); |
| 164 | | - } |
| 165 | | - |
| 166 | | - if ( $wgOpenStackManagerPuppetOptions['availablevariables'] ) { |
| 167 | | - foreach ( $wgOpenStackManagerPuppetOptions['availablevariables'] as $variable ) { |
| 168 | | - $instanceInfo["$variable"] = array( |
| 169 | | - 'type' => 'text', |
| 170 | | - 'section' => 'instance/puppetinfo', |
| 171 | | - 'label' => $variable, |
| 172 | | - ); |
| 173 | | - } |
| 174 | | - } |
| 175 | | - } |
| 176 | | - |
| 177 | | - $instanceInfo['action'] = array( |
| 178 | | - 'type' => 'hidden', |
| 179 | | - 'default' => 'create', |
| 180 | | - ); |
| 181 | | - |
| 182 | | - $instanceForm = new SpecialNovaInstanceForm( $instanceInfo, 'openstackmanager-novainstance' ); |
| 183 | | - $instanceForm->setTitle( SpecialPage::getTitleFor( 'NovaInstance' ) ); |
| 184 | | - $instanceForm->setSubmitID( 'openstackmanager-novainstance-createinstancesubmit' ); |
| 185 | | - $instanceForm->setSubmitCallback( array( $this, 'tryCreateSubmit' ) ); |
| 186 | | - $instanceForm->show(); |
| 187 | | - |
| 188 | | - } |
| 189 | | - |
| 190 | | - function configureInstance() { |
| 191 | | - global $wgRequest, $wgOut; |
| 192 | | - global $wgOpenStackManagerPuppetOptions; |
| 193 | | - |
| 194 | | - $this->setHeaders(); |
| 195 | | - $wgOut->setPagetitle( wfMsg( 'openstackmanager-configureinstance' ) ); |
| 196 | | - |
| 197 | | - $instanceid = $wgRequest->getText( 'instanceid' ); |
| 198 | | - |
| 199 | | - $instanceInfo = Array(); |
| 200 | | - $instanceInfo['instanceid'] = array( |
| 201 | | - 'type' => 'hidden', |
| 202 | | - 'default' => $instanceid, |
| 203 | | - ); |
| 204 | | - $instanceInfo['project'] = array( |
| 205 | | - 'type' => 'hidden', |
| 206 | | - 'default' => $wgRequest->getText( 'project' ), |
| 207 | | - ); |
| 208 | | - |
| 209 | | - if ( $wgOpenStackManagerPuppetOptions['enabled'] ) { |
| 210 | | - $host = OpenStackNovaHost::getHostByInstanceId( $instanceid ); |
| 211 | | - if ( ! $host ) { |
| 212 | | - $wgOut->addHTML( Html::element( 'p', array(), wfMsg( 'openstackmanager-nonexistanthost' ) ) ); |
| 213 | | - return false; |
| 214 | | - } |
| 215 | | - $puppetinfo = $host->getPuppetConfiguration(); |
| 216 | | - |
| 217 | | - if ( $wgOpenStackManagerPuppetOptions['availableclasses'] ) { |
| 218 | | - $classes = array(); |
| 219 | | - $defaults = array(); |
| 220 | | - foreach ( $wgOpenStackManagerPuppetOptions['availableclasses'] as $class ) { |
| 221 | | - $classes["$class"] = $class; |
| 222 | | - if ( in_array( $class, $puppetinfo['puppetclass'] ) ) { |
| 223 | | - $defaults["$class"] = $class; |
| 224 | | - } |
| 225 | | - } |
| 226 | | - $instanceInfo['puppetclasses'] = array( |
| 227 | | - 'type' => 'multiselect', |
| 228 | | - 'section' => 'instance/puppetinfo', |
| 229 | | - 'options' => $classes, |
| 230 | | - 'default' => $defaults, |
| 231 | | - 'label-message' => 'openstackmanager-puppetclasses', |
| 232 | | - ); |
| 233 | | - } |
| 234 | | - |
| 235 | | - if ( $wgOpenStackManagerPuppetOptions['availablevariables'] ) { |
| 236 | | - foreach ( $wgOpenStackManagerPuppetOptions['availablevariables'] as $variable ) { |
| 237 | | - $default = ''; |
| 238 | | - if ( array_key_exists( $variable, $puppetinfo['puppetvar'] ) ) { |
| 239 | | - $default = $puppetinfo['puppetvar']["$variable"]; |
| 240 | | - } |
| 241 | | - $instanceInfo["$variable"] = array( |
| 242 | | - 'type' => 'text', |
| 243 | | - 'section' => 'instance/puppetinfo', |
| 244 | | - 'label' => $variable, |
| 245 | | - 'default' => $default, |
| 246 | | - ); |
| 247 | | - } |
| 248 | | - } |
| 249 | | - } |
| 250 | | - |
| 251 | | - $instanceInfo['action'] = array( |
| 252 | | - 'type' => 'hidden', |
| 253 | | - 'default' => 'configure', |
| 254 | | - ); |
| 255 | | - |
| 256 | | - $instanceForm = new SpecialNovaInstanceForm( $instanceInfo, 'openstackmanager-novainstance' ); |
| 257 | | - $instanceForm->setTitle( SpecialPage::getTitleFor( 'NovaInstance' ) ); |
| 258 | | - $instanceForm->setSubmitID( 'novainstance-form-configureinstancesubmit' ); |
| 259 | | - $instanceForm->setSubmitCallback( array( $this, 'tryConfigureSubmit' ) ); |
| 260 | | - $instanceForm->show(); |
| 261 | | - |
| 262 | | - return true; |
| 263 | | - } |
| 264 | | - |
| 265 | | - function deleteInstance() { |
| 266 | | - global $wgOut, $wgRequest; |
| 267 | | - |
| 268 | | - $this->setHeaders(); |
| 269 | | - $wgOut->setPagetitle( wfMsg( 'openstackmanager-deletedomain' ) ); |
| 270 | | - |
| 271 | | - $instanceid = $wgRequest->getText( 'instanceid' ); |
| 272 | | - $project = $wgRequest->getText( 'project' ); |
| 273 | | - if ( ! $wgRequest->wasPosted() ) { |
| 274 | | - $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-deleteinstancequestion', array(), $instanceid ) ); |
| 275 | | - $wgOut->addHTML( $out ); |
| 276 | | - } |
| 277 | | - $instanceInfo = Array(); |
| 278 | | - $instanceInfo['instanceid'] = array( |
| 279 | | - 'type' => 'hidden', |
| 280 | | - 'default' => $instanceid, |
| 281 | | - ); |
| 282 | | - $instanceInfo['project'] = array( |
| 283 | | - 'type' => 'hidden', |
| 284 | | - 'default' => $project, |
| 285 | | - ); |
| 286 | | - $instanceInfo['action'] = array( |
| 287 | | - 'type' => 'hidden', |
| 288 | | - 'default' => 'delete', |
| 289 | | - ); |
| 290 | | - $instanceForm = new SpecialNovaInstanceForm( $instanceInfo, 'openstackmanager-novainstance' ); |
| 291 | | - $instanceForm->setTitle( SpecialPage::getTitleFor( 'NovaInstance' ) ); |
| 292 | | - $instanceForm->setSubmitID( 'novainstance-form-deleteinstancesubmit' ); |
| 293 | | - $instanceForm->setSubmitCallback( array( $this, 'tryDeleteSubmit' ) ); |
| 294 | | - $instanceForm->setSubmitText( 'confirm' ); |
| 295 | | - $instanceForm->show(); |
| 296 | | - |
| 297 | | - return true; |
| 298 | | - } |
| 299 | | - |
| 300 | | - function modifyInstance() { |
| 301 | | - return true; |
| 302 | | - } |
| 303 | | - |
| 304 | | - function listInstances() { |
| 305 | | - global $wgOut, $wgUser; |
| 306 | | - |
| 307 | | - $this->setHeaders(); |
| 308 | | - $wgOut->setPagetitle( wfMsg( 'openstackmanager-instancelist' ) ); |
| 309 | | - |
| 310 | | - $userProjects = $this->userLDAP->getProjects(); |
| 311 | | - $sk = $wgUser->getSkin(); |
| 312 | | - $out = ''; |
| 313 | | - $instances = $this->adminNova->getInstances(); |
| 314 | | - $header = Html::element( 'th', array(), wfMsg( 'openstackmanager-instancename' ) ); |
| 315 | | - $header .= Html::element( 'th', array(), wfMsg( 'openstackmanager-instanceid' ) ); |
| 316 | | - $header .= Html::element( 'th', array(), wfMsg( 'openstackmanager-instancestate' ) ); |
| 317 | | - $header .= Html::element( 'th', array(), wfMsg( 'openstackmanager-instancetype' ) ); |
| 318 | | - $header .= Html::element( 'th', array(), wfMsg( 'openstackmanager-instanceip' ) ); |
| 319 | | - $header .= Html::element( 'th', array(), wfMsg( 'openstackmanager-imageid' ) ); |
| 320 | | - $header .= Html::element( 'th', array(), wfMsg( 'openstackmanager-actions' ) ); |
| 321 | | - $projectArr = array(); |
| 322 | | - foreach ( $instances as $instance ) { |
| 323 | | - $project = $instance->getOwner(); |
| 324 | | - if ( ! in_array( $project, $userProjects ) ) { |
| 325 | | - continue; |
| 326 | | - } |
| 327 | | - $instanceName = (string)$instance->getInstanceName(); |
| 328 | | - $title = Title::newFromText( $instanceName, NS_VM ); |
| 329 | | - $instanceNameLink = $sk->link( $title, $instanceName, array(), array(), array() ); |
| 330 | | - $instanceOut = Html::rawElement( 'td', array(), $instanceNameLink ); |
| 331 | | - $instanceOut .= Html::element( 'td', array(), $instance->getInstanceId() ); |
| 332 | | - $instanceOut .= Html::element( 'td', array(), $instance->getInstanceState() ); |
| 333 | | - $instanceOut .= Html::element( 'td', array(), $instance->getInstanceType() ); |
| 334 | | - $instanceOut .= Html::element( 'td', array(), $instance->getInstancePrivateIP() ); |
| 335 | | - $instanceOut .= Html::element( 'td', array(), $instance->getImageId() ); |
| 336 | | - $msg = wfMsg( 'openstackmanager-delete' ); |
| 337 | | - $actions = $sk->link( $this->getTitle(), $msg, array(), |
| 338 | | - array( 'action' => 'delete', |
| 339 | | - 'project' => $project, |
| 340 | | - 'instanceid' => $instance->getInstanceId() ), |
| 341 | | - array() ); |
| 342 | | - $actions .= ', '; |
| 343 | | - $msg = wfMsg( 'openstackmanager-rename' ); |
| 344 | | - $actions .= $sk->link( $this->getTitle(), $msg, array(), |
| 345 | | - array( 'action' => 'rename', |
| 346 | | - 'project' => $project, |
| 347 | | - 'instanceid' => $instance->getInstanceId() ), |
| 348 | | - array() ); |
| 349 | | - $actions .= ', '; |
| 350 | | - $msg = wfMsg( 'openstackmanager-configure' ); |
| 351 | | - $actions .= $sk->link( $this->getTitle(), $msg, array(), |
| 352 | | - array( 'action' => 'configure', |
| 353 | | - 'project' => $project, |
| 354 | | - 'instanceid' => $instance->getInstanceId() ), |
| 355 | | - array() ); |
| 356 | | - $instanceOut .= Html::rawElement( 'td', array(), $actions ); |
| 357 | | - $projectArr["$project"] .= Html::rawElement( 'tr', array(), $instanceOut ); |
| 358 | | - } |
| 359 | | - foreach ( $userProjects as $project ) { |
| 360 | | - $out .= Html::element( 'h2', array(), $project ); |
| 361 | | - $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-createinstance' ), array(), |
| 362 | | - array( 'action' => 'create', 'project' => $project ), array() ); |
| 363 | | - if ( isset( $projectArr["$project"] ) ) { |
| 364 | | - $projectOut = $header; |
| 365 | | - $projectOut .= $projectArr["$project"]; |
| 366 | | - $out .= Html::rawElement( 'table', |
| 367 | | - array( 'id' => 'novainstancelist', 'class' => 'wikitable' ), $projectOut ); |
| 368 | | - } |
| 369 | | - } |
| 370 | | - |
| 371 | | - $wgOut->addHTML( $out ); |
| 372 | | - } |
| 373 | | - |
| 374 | | - function tryCreateSubmit( $formData, $entryPoint = 'internal' ) { |
| 375 | | - global $wgOut, $wgUser; |
| 376 | | - global $wgOpenStackManagerPuppetOptions; |
| 377 | | - |
| 378 | | - $sk = $wgUser->getSkin(); |
| 379 | | - $domain = OpenStackNovaDomain::getDomainByName( $formData['domain'] ); |
| 380 | | - if ( ! $domain ) { |
| 381 | | - $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-invaliddomain' ) ); |
| 382 | | - return false; |
| 383 | | - } |
| 384 | | - $instance = $this->userNova->createInstance( $formData['instancename'], $formData['imageType'], '', $formData['instanceType'], $formData['availabilityZone'] ); |
| 385 | | - if ( $instance ) { |
| 386 | | - $puppetinfo = array(); |
| 387 | | - if ( $wgOpenStackManagerPuppetOptions['enabled'] ) { |
| 388 | | - foreach ( $formData['puppetclasses'] as $class ) { |
| 389 | | - if ( in_array( $class, $wgOpenStackManagerPuppetOptions['availableclasses'] ) ) { |
| 390 | | - $puppetinfo['classes'][] = $class; |
| 391 | | - } |
| 392 | | - } |
| 393 | | - foreach ( $wgOpenStackManagerPuppetOptions['availablevariables'] as $variable ) { |
| 394 | | - if ( isset ( $formData["$variable"] ) ) { |
| 395 | | - $puppetinfo['variables']["$variable"] = $formData["$variable"]; |
| 396 | | - } |
| 397 | | - } |
| 398 | | - } |
| 399 | | - $host = OpenStackNovaHost::addHost( $instance, $domain, $puppetinfo ); |
| 400 | | - |
| 401 | | - if ( $host ) { |
| 402 | | - $title = Title::newFromText( $wgOut->getPageTitle() ); |
| 403 | | - $job = new OpenStackNovaHostJob( $title, array( 'instanceid' => (string)$instance->getInstanceId() ) ); |
| 404 | | - $job->insert(); |
| 405 | | - $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-createdinstance', array(), |
| 406 | | - $instance->getInstanceID(), $instance->getImageId(), |
| 407 | | - $host->getFullyQualifiedHostName() ) ); |
| 408 | | - } else { |
| 409 | | - $this->userNova->terminateInstance( $instance->getInstanceId() ); |
| 410 | | - $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-createfailedldap' ) ); |
| 411 | | - } |
| 412 | | - # TODO: also add puppet |
| 413 | | - } else { |
| 414 | | - $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-createinstancefailed' ) ); |
| 415 | | - } |
| 416 | | - $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backinstancelist' ), array(), array(), array() ); |
| 417 | | - |
| 418 | | - $wgOut->addHTML( $out ); |
| 419 | | - return true; |
| 420 | | - } |
| 421 | | - |
| 422 | | - function tryDeleteSubmit( $formData, $entryPoint = 'internal' ) { |
| 423 | | - global $wgOut, $wgUser; |
| 424 | | - |
| 425 | | - $sk = $wgUser->getSkin(); |
| 426 | | - $instance = $this->adminNova->getInstance( $formData['instanceid'] ); |
| 427 | | - if ( ! $instance ) { |
| 428 | | - $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-nonexistanthost' ) ); |
| 429 | | - return true; |
| 430 | | - } |
| 431 | | - $instancename = $instance->getInstanceName(); |
| 432 | | - $instanceid = $instance->getInstanceId(); |
| 433 | | - $success = $this->userNova->terminateInstance( $instanceid ); |
| 434 | | - if ( $success ) { |
| 435 | | - $success = OpenStackNovaHost::deleteHostByInstanceId( $instanceid ); |
| 436 | | - if ( $success ) { |
| 437 | | - $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-deletedinstance', array(), $instanceid ) ); |
| 438 | | - } else { |
| 439 | | - $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-deletedinstance-faileddns', array(), $instancename, $instanceid ) ); |
| 440 | | - } |
| 441 | | - } else { |
| 442 | | - $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-deleteinstancefailed' ) ); |
| 443 | | - } |
| 444 | | - $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backinstancelist' ), array(), array(), array() ); |
| 445 | | - |
| 446 | | - $wgOut->addHTML( $out ); |
| 447 | | - return true; |
| 448 | | - } |
| 449 | | - |
| 450 | | - function tryConfigureSubmit( $formData, $entryPoint = 'internal' ) { |
| 451 | | - global $wgOut, $wgUser; |
| 452 | | - global $wgOpenStackManagerPuppetOptions; |
| 453 | | - |
| 454 | | - $sk = $wgUser->getSkin(); |
| 455 | | - $host = OpenStackNovaHost::getHostByInstanceId( $formData['instanceid'] ); |
| 456 | | - if ( $host ) { |
| 457 | | - $puppetinfo = array(); |
| 458 | | - if ( $wgOpenStackManagerPuppetOptions['enabled'] ) { |
| 459 | | - foreach ( $formData['puppetclasses'] as $class ) { |
| 460 | | - if ( in_array( $class, $wgOpenStackManagerPuppetOptions['availableclasses'] ) ) { |
| 461 | | - $puppetinfo['classes'][] = $class; |
| 462 | | - } |
| 463 | | - } |
| 464 | | - foreach ( $wgOpenStackManagerPuppetOptions['availablevariables'] as $variable ) { |
| 465 | | - if ( isset ( $formData["$variable"] ) ) { |
| 466 | | - $puppetinfo['variables']["$variable"] = $formData["$variable"]; |
| 467 | | - } |
| 468 | | - } |
| 469 | | - } |
| 470 | | - $success = $host->modifyPuppetConfiguration( $puppetinfo ); |
| 471 | | - if ( $success ) { |
| 472 | | - $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-modifiedinstance' ) ); |
| 473 | | - } else { |
| 474 | | - $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-modifyinstancefailed' ) ); |
| 475 | | - } |
| 476 | | - } else { |
| 477 | | - $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-nonexistanthost' ) ); |
| 478 | | - } |
| 479 | | - $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backinstancelist' ), array(), array(), array() ); |
| 480 | | - |
| 481 | | - $wgOut->addHTML( $out ); |
| 482 | | - return true; |
| 483 | | - } |
| 484 | | - |
| 485 | | - function validateInstanceName( $instancename, $alldata ) { |
| 486 | | - if ( ! preg_match( "/^[a-z][a-z0-9\-]*$/", $instancename ) ) { |
| 487 | | - return Xml::element( 'span', array( 'class' => 'error' ), wfMsg( 'openstackmanager-badinstancename' ) ); |
| 488 | | - } else { |
| 489 | | - return true; |
| 490 | | - } |
| 491 | | - } |
| 492 | | - |
| 493 | | -} |
| 494 | | - |
| 495 | | -class SpecialNovaInstanceForm extends HTMLForm { |
| 496 | | -} |
| Index: trunk/extensions/OpenStackManager/SpecialNovaProject.php |
| — | — | @@ -1,303 +0,0 @@ |
| 2 | | -<?php |
| 3 | | -class SpecialNovaProject extends SpecialNova { |
| 4 | | - |
| 5 | | - var $userNova, $adminNova; |
| 6 | | - |
| 7 | | - function __construct() { |
| 8 | | - parent::__construct( 'NovaProject' ); |
| 9 | | - |
| 10 | | - global $wgOpenStackManagerNovaAdminKeys; |
| 11 | | - |
| 12 | | - $this->userLDAP = new OpenStackNovaUser(); |
| 13 | | - $adminCredentials = $wgOpenStackManagerNovaAdminKeys; |
| 14 | | - $this->adminNova = new OpenStackNovaController( $adminCredentials ); |
| 15 | | - } |
| 16 | | - |
| 17 | | - public function isRestricted() { |
| 18 | | - return true; |
| 19 | | - } |
| 20 | | - |
| 21 | | -# public function userCanExecute( $user ) { |
| 22 | | -# global $wgRequest; |
| 23 | | -# |
| 24 | | -# #$project = $wgRequest->getVal('project'); |
| 25 | | -# #if ( $project && ! $this->userLDAP->inProject( $project ) ) { |
| 26 | | -# # return false; |
| 27 | | -# #} |
| 28 | | -# return true; |
| 29 | | -# } |
| 30 | | - |
| 31 | | - function execute( $par ) { |
| 32 | | - global $wgRequest, $wgUser; |
| 33 | | - |
| 34 | | - # if ( ! $wgUser->isAllowed( 'manageproject' ) ) { |
| 35 | | - # return false; |
| 36 | | - # } |
| 37 | | - if ( ! $wgUser->isLoggedIn() ) { |
| 38 | | - $this->notLoggedIn(); |
| 39 | | - return false; |
| 40 | | - } |
| 41 | | - |
| 42 | | - $action = $wgRequest->getVal( 'action' ); |
| 43 | | - if ( $action == "create" ) { |
| 44 | | - $this->createProject(); |
| 45 | | - } else if ( $action == "delete" ) { |
| 46 | | - $this->deleteProject(); |
| 47 | | - } else if ( $action == "addmember" ) { |
| 48 | | - $this->addMember(); |
| 49 | | - } else if ( $action == "deletemember" ) { |
| 50 | | - $this->deleteMember(); |
| 51 | | - } else { |
| 52 | | - $this->listProjects(); |
| 53 | | - } |
| 54 | | - } |
| 55 | | - |
| 56 | | - function createProject() { |
| 57 | | - global $wgRequest, $wgOut; |
| 58 | | - |
| 59 | | - $this->setHeaders(); |
| 60 | | - $wgOut->setPagetitle( wfMsg( 'openstackmanager-createproject' ) ); |
| 61 | | - |
| 62 | | - $projectInfo = Array(); |
| 63 | | - $projectInfo['projectname'] = array( |
| 64 | | - 'type' => 'text', |
| 65 | | - 'label-message' => 'openstackmanager-projectname', |
| 66 | | - 'default' => '', |
| 67 | | - 'section' => 'project/info', |
| 68 | | - ); |
| 69 | | - |
| 70 | | - $projectInfo['action'] = array( |
| 71 | | - 'type' => 'hidden', |
| 72 | | - 'default' => 'create', |
| 73 | | - ); |
| 74 | | - |
| 75 | | - $projectForm = new SpecialNovaProjectForm( $projectInfo, 'openstackmanager-novaproject' ); |
| 76 | | - $projectForm->setTitle( SpecialPage::getTitleFor( 'NovaProject' ) ); |
| 77 | | - $projectForm->setSubmitID( 'novaproject-form-createprojectsubmit' ); |
| 78 | | - $projectForm->setSubmitCallback( array( $this, 'tryCreateSubmit' ) ); |
| 79 | | - $projectForm->show(); |
| 80 | | - |
| 81 | | - return true; |
| 82 | | - } |
| 83 | | - |
| 84 | | - function addMember() { |
| 85 | | - global $wgRequest, $wgOut; |
| 86 | | - |
| 87 | | - $this->setHeaders(); |
| 88 | | - $wgOut->setPagetitle( wfMsg( 'openstackmanager-addmember' ) ); |
| 89 | | - |
| 90 | | - $project = $wgRequest->getText( 'projectname' ); |
| 91 | | - $projectInfo = Array(); |
| 92 | | - $projectInfo['member'] = array( |
| 93 | | - 'type' => 'text', |
| 94 | | - 'label-message' => 'openstackmanager-member', |
| 95 | | - 'default' => '', |
| 96 | | - 'section' => 'project/info', |
| 97 | | - ); |
| 98 | | - $projectInfo['action'] = array( |
| 99 | | - 'type' => 'hidden', |
| 100 | | - 'default' => 'addmember', |
| 101 | | - ); |
| 102 | | - $projectInfo['projectname'] = array( |
| 103 | | - 'type' => 'hidden', |
| 104 | | - 'default' => $project, |
| 105 | | - ); |
| 106 | | - |
| 107 | | - $projectForm = new SpecialNovaProjectForm( $projectInfo, 'openstackmanager-novaproject' ); |
| 108 | | - $projectForm->setTitle( SpecialPage::getTitleFor( 'NovaProject' ) ); |
| 109 | | - $projectForm->setSubmitID( 'novaproject-form-addmembersubmit' ); |
| 110 | | - $projectForm->setSubmitCallback( array( $this, 'tryAddMemberSubmit' ) ); |
| 111 | | - $projectForm->show(); |
| 112 | | - |
| 113 | | - return true; |
| 114 | | - } |
| 115 | | - |
| 116 | | - function deleteMember() { |
| 117 | | - global $wgRequest, $wgOut; |
| 118 | | - |
| 119 | | - $this->setHeaders(); |
| 120 | | - $wgOut->setPagetitle( wfMsg( 'openstackmanager-removemember' ) ); |
| 121 | | - |
| 122 | | - $member = $wgRequest->getText( 'member' ); |
| 123 | | - $project = $wgRequest->getText( 'projectname' ); |
| 124 | | - if ( ! $wgRequest->wasPosted() ) { |
| 125 | | - $out .= Html::element( 'p', array(), wfMsgExt( 'openstackmanager-removememberconfirm', array(), $member, $project ) ); |
| 126 | | - $wgOut->addHTML( $out ); |
| 127 | | - } |
| 128 | | - $projectInfo = Array(); |
| 129 | | - $projectInfo['member'] = array( |
| 130 | | - 'type' => 'hidden', |
| 131 | | - 'default' => $member, |
| 132 | | - ); |
| 133 | | - $projectInfo['action'] = array( |
| 134 | | - 'type' => 'hidden', |
| 135 | | - 'default' => 'deletemember', |
| 136 | | - ); |
| 137 | | - $projectInfo['projectname'] = array( |
| 138 | | - 'type' => 'hidden', |
| 139 | | - 'default' => $project, |
| 140 | | - ); |
| 141 | | - |
| 142 | | - $projectForm = new SpecialNovaProjectForm( $projectInfo, 'openstackmanager-novaproject' ); |
| 143 | | - $projectForm->setTitle( SpecialPage::getTitleFor( 'NovaProject' ) ); |
| 144 | | - $projectForm->setSubmitID( 'novaproject-form-deletemembersubmit' ); |
| 145 | | - $projectForm->setSubmitCallback( array( $this, 'tryDeleteMemberSubmit' ) ); |
| 146 | | - $projectForm->show(); |
| 147 | | - |
| 148 | | - return true; |
| 149 | | - } |
| 150 | | - |
| 151 | | - function deleteProject() { |
| 152 | | - global $wgOut, $wgRequest; |
| 153 | | - |
| 154 | | - $this->setHeaders(); |
| 155 | | - $wgOut->setPagetitle( wfMsg( 'openstackmanager-deleteproject' ) ); |
| 156 | | - |
| 157 | | - $project = $wgRequest->getText( 'projectname' ); |
| 158 | | - if ( ! $wgRequest->wasPosted() ) { |
| 159 | | - $out .= Html::element( 'p', array(), wfMsgExt( 'openstackmanager-removeprojectconfirm', array(), $project ) ); |
| 160 | | - $wgOut->addHTML( $out ); |
| 161 | | - } |
| 162 | | - $projectInfo = Array(); |
| 163 | | - $projectInfo['projectname'] = array( |
| 164 | | - 'type' => 'hidden', |
| 165 | | - 'default' => $project, |
| 166 | | - ); |
| 167 | | - $projectInfo['action'] = array( |
| 168 | | - 'type' => 'hidden', |
| 169 | | - 'default' => 'delete', |
| 170 | | - ); |
| 171 | | - $projectForm = new SpecialNovaProjectForm( $projectInfo, 'openstackmanager-novaproject' ); |
| 172 | | - $projectForm->setTitle( SpecialPage::getTitleFor( 'NovaProject' ) ); |
| 173 | | - $projectForm->setSubmitID( 'novaproject-form-deleteprojectsubmit' ); |
| 174 | | - $projectForm->setSubmitCallback( array( $this, 'tryDeleteSubmit' ) ); |
| 175 | | - $projectForm->setSubmitText( 'confirm' ); |
| 176 | | - $projectForm->show(); |
| 177 | | - |
| 178 | | - return true; |
| 179 | | - } |
| 180 | | - |
| 181 | | - function listProjects() { |
| 182 | | - global $wgOut, $wgUser; |
| 183 | | - |
| 184 | | - $this->setHeaders(); |
| 185 | | - $wgOut->setPagetitle( wfMsg( 'openstackmanager-projectlist' ) ); |
| 186 | | - |
| 187 | | - $out = ''; |
| 188 | | - $sk = $wgUser->getSkin(); |
| 189 | | - $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-createproject' ), array(), array( 'action' => 'create' ), array() ); |
| 190 | | - $projectsOut = Html::element( 'th', array(), wfMsg( 'openstackmanager-projectname' ) ); |
| 191 | | - $projectsOut .= Html::element( 'th', array(), wfMsg( 'openstackmanager-members' ) ); |
| 192 | | - $projectsOut .= Html::element( 'th', array(), wfMsg( 'openstackmanager-actions' ) ); |
| 193 | | - $projects = OpenStackNovaProject::getAllProjects(); |
| 194 | | - if ( ! $projects ) { |
| 195 | | - $projectsOut = ''; |
| 196 | | - } |
| 197 | | - foreach ( $projects as $project ) { |
| 198 | | - $projectName = $project->getProjectName(); |
| 199 | | - $projectOut = Html::element( 'td', array(), $projectName ); |
| 200 | | - $projectMembers = $project->getMembers(); |
| 201 | | - $memberOut = ''; |
| 202 | | - foreach ( $projectMembers as $projectMember ) { |
| 203 | | - $link = $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-removemember' ), array(), |
| 204 | | - array( 'action' => 'deletemember', 'projectname' => $projectName, 'member' => $projectMember ), array() ); |
| 205 | | - $projectMemberOut = htmlentities( $projectMember ) . ' (' . $link . ')'; |
| 206 | | - $memberOut .= Html::rawElement( 'li', array(), $projectMemberOut ); |
| 207 | | - } |
| 208 | | - if ( $memberOut ) { |
| 209 | | - $memberOut .= '<br />'; |
| 210 | | - $memberOut = Html::rawElement( 'ul', array(), $memberOut ); |
| 211 | | - } |
| 212 | | - $memberOut .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-addmember' ), array(), |
| 213 | | - array( 'action' => 'addmember', 'projectname' => $projectName ), array() ); |
| 214 | | - $projectOut .= Html::rawElement( 'td', array(), $memberOut ); |
| 215 | | - $link = $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-deleteproject' ), array(), |
| 216 | | - array( 'action' => 'delete', 'projectname' => $projectName ), array() ); |
| 217 | | - $projectOut .= Html::rawElement( 'td', array(), $link ); |
| 218 | | - $projectsOut .= Html::rawElement( 'tr', array(), $projectOut ); |
| 219 | | - } |
| 220 | | - if ( $projectsOut ) { |
| 221 | | - $out .= Html::rawElement( 'table', array( 'class' => 'wikitable' ), $projectsOut ); |
| 222 | | - } |
| 223 | | - |
| 224 | | - $wgOut->addHTML( $out ); |
| 225 | | - } |
| 226 | | - |
| 227 | | - function tryCreateSubmit( $formData, $entryPoint = 'internal' ) { |
| 228 | | - global $wgOut, $wgUser; |
| 229 | | - |
| 230 | | - $success = OpenStackNovaProject::createProject( $formData['projectname'] ); |
| 231 | | - if ( ! $success ) { |
| 232 | | - $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-createprojectfailed' ) ); |
| 233 | | - $wgOut->addHTML( $out ); |
| 234 | | - return false; |
| 235 | | - } |
| 236 | | - $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-createdproject' ) ); |
| 237 | | - $out .= '<br />'; |
| 238 | | - $sk = $wgUser->getSkin(); |
| 239 | | - $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backprojectlist' ), array(), array(), array() ); |
| 240 | | - $wgOut->addHTML( $out ); |
| 241 | | - |
| 242 | | - return true; |
| 243 | | - } |
| 244 | | - |
| 245 | | - function tryDeleteSubmit( $formData, $entryPoint = 'internal' ) { |
| 246 | | - global $wgOut, $wgUser; |
| 247 | | - |
| 248 | | - $success = OpenStackNovaProject::deleteProject( $formData['projectname'] ); |
| 249 | | - if ( $success ) { |
| 250 | | - $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-deletedproject' ) ); |
| 251 | | - } else { |
| 252 | | - $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-deleteprojectfailed' ) ); |
| 253 | | - } |
| 254 | | - $out .= '<br />'; |
| 255 | | - $sk = $wgUser->getSkin(); |
| 256 | | - $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backprojectlist' ), array(), array(), array() ); |
| 257 | | - $wgOut->addHTML( $out ); |
| 258 | | - |
| 259 | | - return true; |
| 260 | | - } |
| 261 | | - |
| 262 | | - function tryAddMemberSubmit( $formData, $entryPoint = 'internal' ) { |
| 263 | | - global $wgOut, $wgUser; |
| 264 | | - |
| 265 | | - $project = new OpenStackNovaProject( $formData['projectname'] ); |
| 266 | | - $success = $project->addMember( $formData['member'] ); |
| 267 | | - if ( $success ) { |
| 268 | | - $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-addedto', array(), $formData['member'], |
| 269 | | - $formData['projectname'] ) ); |
| 270 | | - } else { |
| 271 | | - $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-failedtoadd', array(), $formData['member'], |
| 272 | | - $formData['projectname'] ) ); |
| 273 | | - } |
| 274 | | - $out .= '<br />'; |
| 275 | | - $sk = $wgUser->getSkin(); |
| 276 | | - $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backprojectlist' ), array(), array(), array() ); |
| 277 | | - $wgOut->addHTML( $out ); |
| 278 | | - |
| 279 | | - return true; |
| 280 | | - } |
| 281 | | - |
| 282 | | - function tryDeleteMemberSubmit( $formData, $entryPoint = 'internal' ) { |
| 283 | | - global $wgOut, $wgUser; |
| 284 | | - |
| 285 | | - $project = new OpenStackNovaProject( $formData['projectname'] ); |
| 286 | | - $success = $project->deleteMember( $formData['member'] ); |
| 287 | | - if ( $success ) { |
| 288 | | - $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-removedfrom', array(), $formData['member'], |
| 289 | | - $formData['projectname'] ) ); |
| 290 | | - } else { |
| 291 | | - $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-failedtoremove', array(), $formData['member'], |
| 292 | | - $formData['projectname'] ) ); |
| 293 | | - } |
| 294 | | - $out .= '<br />'; |
| 295 | | - $sk = $wgUser->getSkin(); |
| 296 | | - $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backprojectlist' ), array(), array(), array() ); |
| 297 | | - $wgOut->addHTML( $out ); |
| 298 | | - |
| 299 | | - return true; |
| 300 | | - } |
| 301 | | -} |
| 302 | | - |
| 303 | | -class SpecialNovaProjectForm extends HTMLForm { |
| 304 | | -} |
| Index: trunk/extensions/OpenStackManager/SpecialNovaDomain.php |
| — | — | @@ -1,182 +0,0 @@ |
| 2 | | -<?php |
| 3 | | -class SpecialNovaDomain extends SpecialNova { |
| 4 | | - |
| 5 | | - var $userNova, $adminNova; |
| 6 | | - |
| 7 | | - function __construct() { |
| 8 | | - parent::__construct( 'NovaDomain' ); |
| 9 | | - |
| 10 | | - global $wgOpenStackManagerNovaAdminKeys; |
| 11 | | - |
| 12 | | - $this->userLDAP = new OpenStackNovaUser(); |
| 13 | | - $this->adminNova = new OpenStackNovaController( $wgOpenStackManagerNovaAdminKeys ); |
| 14 | | - } |
| 15 | | - |
| 16 | | - public function isRestricted() { |
| 17 | | - return true; |
| 18 | | - } |
| 19 | | - |
| 20 | | - function execute( $par ) { |
| 21 | | - global $wgRequest, $wgUser; |
| 22 | | - |
| 23 | | - # if ( ! $wgUser->isAllowed( 'manageproject' ) ) { |
| 24 | | - # return false; |
| 25 | | - # } |
| 26 | | - if ( ! $wgUser->isLoggedIn() ) { |
| 27 | | - $this->notLoggedIn(); |
| 28 | | - return false; |
| 29 | | - } |
| 30 | | - |
| 31 | | - $action = $wgRequest->getVal( 'action' ); |
| 32 | | - if ( $action == "create" ) { |
| 33 | | - $this->createDomain(); |
| 34 | | - } else if ( $action == "delete" ) { |
| 35 | | - $this->deleteDomain(); |
| 36 | | - } else { |
| 37 | | - $this->listDomains(); |
| 38 | | - } |
| 39 | | - } |
| 40 | | - |
| 41 | | - function createDomain() { |
| 42 | | - global $wgRequest, $wgOut; |
| 43 | | - global $wgOpenStackManagerDNSOptions; |
| 44 | | - |
| 45 | | - $this->setHeaders(); |
| 46 | | - $wgOut->setPagetitle( wfMsg( 'openstackmanager-createdomain' ) ); |
| 47 | | - |
| 48 | | - $domainInfo = Array(); |
| 49 | | - $domainInfo['domainname'] = array( |
| 50 | | - 'type' => 'text', |
| 51 | | - 'label-message' => 'openstackmanager-domainname', |
| 52 | | - 'default' => '', |
| 53 | | - 'section' => 'domain/info', |
| 54 | | - ); |
| 55 | | - $domainInfo['fqdn'] = array( |
| 56 | | - 'type' => 'text', |
| 57 | | - 'label-message' => 'openstackmanager-fqdn', |
| 58 | | - 'default' => '', |
| 59 | | - 'section' => 'domain/info', |
| 60 | | - ); |
| 61 | | - $domainInfo['location'] = array( |
| 62 | | - 'type' => 'text', |
| 63 | | - 'label-message' => 'openstackmanager-location', |
| 64 | | - 'default' => '', |
| 65 | | - 'section' => 'domain/info', |
| 66 | | - ); |
| 67 | | - $domainInfo['action'] = array( |
| 68 | | - 'type' => 'hidden', |
| 69 | | - 'default' => 'create', |
| 70 | | - ); |
| 71 | | - |
| 72 | | - $domainForm = new SpecialNovaDomainForm( $domainInfo, 'openstackmanager-novadomain' ); |
| 73 | | - $domainForm->setTitle( SpecialPage::getTitleFor( 'NovaDomain' ) ); |
| 74 | | - $domainForm->setSubmitID( 'novadomain-form-createdomainsubmit' ); |
| 75 | | - $domainForm->setSubmitCallback( array( $this, 'tryCreateSubmit' ) ); |
| 76 | | - $domainForm->show(); |
| 77 | | - |
| 78 | | - return true; |
| 79 | | - } |
| 80 | | - |
| 81 | | - function deleteDomain() { |
| 82 | | - global $wgOut, $wgRequest; |
| 83 | | - |
| 84 | | - $this->setHeaders(); |
| 85 | | - $wgOut->setPagetitle( wfMsg( 'openstackmanager-deletedomain' ) ); |
| 86 | | - |
| 87 | | - $domainname = $wgRequest->getText( 'domainname' ); |
| 88 | | - if ( ! $wgRequest->wasPosted() ) { |
| 89 | | - $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-deletedomain-confirm', array(), $domainname ) ); |
| 90 | | - $wgOut->addHTML( $out ); |
| 91 | | - } |
| 92 | | - $domainInfo = Array(); |
| 93 | | - $domainInfo['domainname'] = array( |
| 94 | | - 'type' => 'hidden', |
| 95 | | - 'default' => $domainname, |
| 96 | | - ); |
| 97 | | - $domainInfo['action'] = array( |
| 98 | | - 'type' => 'hidden', |
| 99 | | - 'default' => 'delete', |
| 100 | | - ); |
| 101 | | - $domainForm = new SpecialNovaDomainForm( $domainInfo, 'openstackmanager-novadomain' ); |
| 102 | | - $domainForm->setTitle( SpecialPage::getTitleFor( 'NovaDomain' ) ); |
| 103 | | - $domainForm->setSubmitID( 'novadomain-form-deletedomainsubmit' ); |
| 104 | | - $domainForm->setSubmitCallback( array( $this, 'tryDeleteSubmit' ) ); |
| 105 | | - $domainForm->setSubmitText( 'confirm' ); |
| 106 | | - $domainForm->show(); |
| 107 | | - |
| 108 | | - return true; |
| 109 | | - } |
| 110 | | - |
| 111 | | - function listDomains() { |
| 112 | | - global $wgOut, $wgUser; |
| 113 | | - |
| 114 | | - $this->setHeaders(); |
| 115 | | - $wgOut->setPagetitle( wfMsg( 'openstackmanager-domainlist' ) ); |
| 116 | | - |
| 117 | | - $out = ''; |
| 118 | | - $sk = $wgUser->getSkin(); |
| 119 | | - $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-createdomain' ), array(), array( 'action' => 'create' ), array() ); |
| 120 | | - $domainsOut = Html::element( 'th', array(), wfMsg( 'openstackmanager-domainname' ) ); |
| 121 | | - $domainsOut .= Html::element( 'th', array(), wfMsg( 'openstackmanager-fqdn' ) ); |
| 122 | | - $domainsOut .= Html::element( 'th', array(), wfMsg( 'openstackmanager-location' ) ); |
| 123 | | - $domainsOut .= Html::element( 'th', array(), wfMsg( 'openstackmanager-actions' ) ); |
| 124 | | - $domains = OpenStackNovaDomain::getAllDomains(); |
| 125 | | - foreach ( $domains as $domain ) { |
| 126 | | - $domainName = $domain->getDomainName(); |
| 127 | | - $fqdn = $domain->getFullyQualifiedDomainName(); |
| 128 | | - $location = $domain->getLocation(); |
| 129 | | - $domainOut = Html::element( 'td', array(), $domainName ); |
| 130 | | - $domainOut .= Html::element( 'td', array(), $fqdn ); |
| 131 | | - $domainOut .= Html::element( 'td', array(), $location ); |
| 132 | | - $msg = wfMsg( 'openstackmanager-delete' ); |
| 133 | | - $link = $sk->link( $this->getTitle(), $msg, array(), |
| 134 | | - array( 'action' => 'delete', 'domainname' => $domainName ), array() ); |
| 135 | | - $domainOut .= Html::rawElement( 'td', array(), $link ); |
| 136 | | - $domainsOut .= Html::rawElement( 'tr', array(), $domainOut ); |
| 137 | | - } |
| 138 | | - if ( $domains ) { |
| 139 | | - $out .= Html::rawElement( 'table', array( 'class' => 'wikitable' ), $domainsOut ); |
| 140 | | - } |
| 141 | | - |
| 142 | | - $wgOut->addHTML( $out ); |
| 143 | | - } |
| 144 | | - |
| 145 | | - function tryCreateSubmit( $formData, $entryPoint = 'internal' ) { |
| 146 | | - global $wgOut, $wgUser; |
| 147 | | - |
| 148 | | - $success = OpenStackNovaDomain::createDomain( $formData['domainname'], $formData['fqdn'], $formData['location'] ); |
| 149 | | - if ( ! $success ) { |
| 150 | | - $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-createdomainfailed' ) ); |
| 151 | | - $wgOut->addHTML( $out ); |
| 152 | | - return false; |
| 153 | | - } |
| 154 | | - $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-createddomain' ) ); |
| 155 | | - $out .= '<br />'; |
| 156 | | - $sk = $wgUser->getSkin(); |
| 157 | | - $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backdomainlist' ), array(), array(), array() ); |
| 158 | | - $wgOut->addHTML( $out ); |
| 159 | | - |
| 160 | | - return true; |
| 161 | | - } |
| 162 | | - |
| 163 | | - function tryDeleteSubmit( $formData, $entryPoint = 'internal' ) { |
| 164 | | - global $wgOut, $wgUser; |
| 165 | | - |
| 166 | | - $success = OpenStackNovaDomain::deleteDomain( $formData['domainname'] ); |
| 167 | | - if ( $success ) { |
| 168 | | - $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-deleteddomain' ) ); |
| 169 | | - } else { |
| 170 | | - $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-failedeletedomain' ) ); |
| 171 | | - } |
| 172 | | - $out .= '<br />'; |
| 173 | | - $sk = $wgUser->getSkin(); |
| 174 | | - $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backdomainlist' ), array(), array(), array() ); |
| 175 | | - $wgOut->addHTML( $out ); |
| 176 | | - |
| 177 | | - return true; |
| 178 | | - } |
| 179 | | - |
| 180 | | -} |
| 181 | | - |
| 182 | | -class SpecialNovaDomainForm extends HTMLForm { |
| 183 | | -} |
| Index: trunk/extensions/OpenStackManager/SpecialNova.php |
| — | — | @@ -1,27 +0,0 @@ |
| 2 | | -<?php |
| 3 | | - |
| 4 | | -abstract class SpecialNova extends SpecialPage { |
| 5 | | - function notLoggedIn() { |
| 6 | | - global $wgOut; |
| 7 | | - |
| 8 | | - $this->setHeaders(); |
| 9 | | - $wgOut->setPagetitle( wfMsg( 'openstackmanager-notloggedin' ) ); |
| 10 | | - $wgOut->addHTML( wfMsg( 'openstackmanager-mustbeloggedin' ) ); |
| 11 | | - } |
| 12 | | - |
| 13 | | - function noCredentials() { |
| 14 | | - global $wgOut; |
| 15 | | - |
| 16 | | - $this->setHeaders(); |
| 17 | | - $wgOut->setPagetitle( wfMsg( 'openstackmanager-nonovacred' ) ); |
| 18 | | - $wgOut->addHTML( wfMsg( 'openstackmanager-nonovacred-admincreate' ) ); |
| 19 | | - } |
| 20 | | - |
| 21 | | - function notInProject() { |
| 22 | | - global $wgOut; |
| 23 | | - |
| 24 | | - $this->setHeaders(); |
| 25 | | - $wgOut->setPagetitle( wfMsg( 'openstackmanager-noaccount' ) ); |
| 26 | | - $wgOut->addHTML( wfMsg( 'openstackmanager-noaccount2' ) ); |
| 27 | | - } |
| 28 | | -} |
| Index: trunk/extensions/OpenStackManager/SpecialNovaAddress.php |
| — | — | @@ -1,333 +0,0 @@ |
| 2 | | -<?php |
| 3 | | -class SpecialNovaAddress extends SpecialNova { |
| 4 | | - |
| 5 | | - var $adminNova; |
| 6 | | - var $userNova; |
| 7 | | - var $userLDAP; |
| 8 | | - |
| 9 | | - function __construct() { |
| 10 | | - parent::__construct( 'NovaAddress' ); |
| 11 | | - } |
| 12 | | - |
| 13 | | - function execute( $par ) { |
| 14 | | - global $wgRequest, $wgUser; |
| 15 | | - global $wgOpenStackManagerNovaAdminKeys; |
| 16 | | - |
| 17 | | - if ( ! $wgUser->isLoggedIn() ) { |
| 18 | | - $this->notLoggedIn(); |
| 19 | | - return false; |
| 20 | | - } |
| 21 | | - $this->userLDAP = new OpenStackNovaUser(); |
| 22 | | - if ( ! $this->userLDAP->exists() ) { |
| 23 | | - $this->noCredentials(); |
| 24 | | - return true; |
| 25 | | - } |
| 26 | | - $adminCredentials = $wgOpenStackManagerNovaAdminKeys; |
| 27 | | - $this->adminNova = new OpenStackNovaController( $adminCredentials ); |
| 28 | | - |
| 29 | | - $action = $wgRequest->getVal( 'action' ); |
| 30 | | - if ( $action == "allocate" ) { |
| 31 | | - $this->allocateAddress(); |
| 32 | | - } else if ( $action == "release" ) { |
| 33 | | - $this->releaseAddress(); |
| 34 | | - } else if ( $action == "associate" ) { |
| 35 | | - $this->associateAddress(); |
| 36 | | - } else if ( $action == "disassociate" ) { |
| 37 | | - $this->disassociateAddress(); |
| 38 | | - } else { |
| 39 | | - $this->listAddresses(); |
| 40 | | - } |
| 41 | | - } |
| 42 | | - |
| 43 | | - function allocateAddress() { |
| 44 | | - global $wgRequest, $wgOut; |
| 45 | | - |
| 46 | | - $this->setHeaders(); |
| 47 | | - $wgOut->setPagetitle( wfMsg( 'openstackmanager-allocateaddress' ) ); |
| 48 | | - |
| 49 | | - $project = $wgRequest->getText( 'project' ); |
| 50 | | - $userCredentials = $this->userLDAP->getCredentials( $project ); |
| 51 | | - $this->userNova = new OpenStackNovaController( $userCredentials ); |
| 52 | | - if ( ! $wgRequest->wasPosted() ) { |
| 53 | | - $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-allocateaddress-confirm', array(), $project ) ); |
| 54 | | - $wgOut->addHTML( $out ); |
| 55 | | - } |
| 56 | | - $addressInfo = Array(); |
| 57 | | - $addressInfo['project'] = array( |
| 58 | | - 'type' => 'hidden', |
| 59 | | - 'default' => $project, |
| 60 | | - ); |
| 61 | | - $addressInfo['action'] = array( |
| 62 | | - 'type' => 'hidden', |
| 63 | | - 'default' => 'allocate', |
| 64 | | - ); |
| 65 | | - |
| 66 | | - $addressForm = new SpecialNovaAddressForm( $addressInfo, 'openstackmanager-novaaddress' ); |
| 67 | | - $addressForm->setTitle( SpecialPage::getTitleFor( 'NovaAddress' ) ); |
| 68 | | - $addressForm->setSubmitID( 'novaaddress-form-allocateaddresssubmit' ); |
| 69 | | - $addressForm->setSubmitCallback( array( $this, 'tryAllocateSubmit' ) ); |
| 70 | | - $addressForm->show(); |
| 71 | | - |
| 72 | | - return true; |
| 73 | | - } |
| 74 | | - |
| 75 | | - function releaseAddress() { |
| 76 | | - global $wgOut, $wgRequest; |
| 77 | | - |
| 78 | | - $this->setHeaders(); |
| 79 | | - $wgOut->setPagetitle( wfMsg( 'openstackmanager-releaseaddress' ) ); |
| 80 | | - |
| 81 | | - $project = $wgRequest->getText( 'project' ); |
| 82 | | - $userCredentials = $this->userLDAP->getCredentials( $project ); |
| 83 | | - $this->userNova = new OpenStackNovaController( $userCredentials ); |
| 84 | | - $ip = $wgRequest->getText( 'ip' ); |
| 85 | | - if ( ! $wgRequest->wasPosted() ) { |
| 86 | | - $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-releaseaddress-confirm', array(), $ip ) ); |
| 87 | | - $wgOut->addHTML( $out ); |
| 88 | | - } |
| 89 | | - $addressInfo = Array(); |
| 90 | | - $addressInfo['project'] = array( |
| 91 | | - 'type' => 'hidden', |
| 92 | | - 'default' => $project, |
| 93 | | - ); |
| 94 | | - $addressInfo['ip'] = array( |
| 95 | | - 'type' => 'hidden', |
| 96 | | - 'default' => $ip, |
| 97 | | - ); |
| 98 | | - $addressInfo['action'] = array( |
| 99 | | - 'type' => 'hidden', |
| 100 | | - 'default' => 'release', |
| 101 | | - ); |
| 102 | | - $addressForm = new SpecialNovaAddressForm( $addressInfo, 'openstackmanager-novaaddress' ); |
| 103 | | - $addressForm->setTitle( SpecialPage::getTitleFor( 'NovaAddress' ) ); |
| 104 | | - $addressForm->setSubmitID( 'novaaddress-form-releaseaddresssubmit' ); |
| 105 | | - $addressForm->setSubmitCallback( array( $this, 'tryReleaseSubmit' ) ); |
| 106 | | - $addressForm->setSubmitText( 'confirm' ); |
| 107 | | - $addressForm->show(); |
| 108 | | - |
| 109 | | - return true; |
| 110 | | - } |
| 111 | | - |
| 112 | | - function associateAddress() { |
| 113 | | - global $wgOut, $wgRequest; |
| 114 | | - |
| 115 | | - $this->setHeaders(); |
| 116 | | - $wgOut->setPagetitle( wfMsg( 'openstackmanager-associateaddress' ) ); |
| 117 | | - |
| 118 | | - $ip = $wgRequest->getText( 'ip' ); |
| 119 | | - $project = $wgRequest->getText( 'project' ); |
| 120 | | - $userCredentials = $this->userLDAP->getCredentials( $project ); |
| 121 | | - $this->userNova = new OpenStackNovaController( $userCredentials ); |
| 122 | | - $instances = $this->userNova->getInstances(); |
| 123 | | - $instance_keys = array(); |
| 124 | | - foreach ( $instances as $instance ) { |
| 125 | | - if ( $instance->getOwner() == $project ) { |
| 126 | | - $instancename = $instance->getInstanceName(); |
| 127 | | - $instanceid = $instance->getInstanceId(); |
| 128 | | - $instance_keys["$instancename"] = $instanceid; |
| 129 | | - } |
| 130 | | - } |
| 131 | | - $addressInfo = array(); |
| 132 | | - $addressInfo['project'] = array( |
| 133 | | - 'type' => 'hidden', |
| 134 | | - 'default' => $project, |
| 135 | | - ); |
| 136 | | - $addressInfo['ip'] = array( |
| 137 | | - 'type' => 'hidden', |
| 138 | | - 'default' => $ip, |
| 139 | | - ); |
| 140 | | - $addressInfo['instanceid'] = array( |
| 141 | | - 'type' => 'select', |
| 142 | | - 'label-message' => 'openstackmanager-instancename', |
| 143 | | - 'options' => $instance_keys, |
| 144 | | - ); |
| 145 | | - $addressInfo['action'] = array( |
| 146 | | - 'type' => 'hidden', |
| 147 | | - 'default' => 'associate', |
| 148 | | - ); |
| 149 | | - $addressForm = new SpecialNovaAddressForm( $addressInfo, 'openstackmanager-novaaddress' ); |
| 150 | | - $addressForm->setTitle( SpecialPage::getTitleFor( 'NovaAddress' ) ); |
| 151 | | - $addressForm->setSubmitID( 'novaaddress-form-releaseaddresssubmit' ); |
| 152 | | - $addressForm->setSubmitCallback( array( $this, 'tryAssociateSubmit' ) ); |
| 153 | | - $addressForm->show(); |
| 154 | | - |
| 155 | | - } |
| 156 | | - |
| 157 | | - function disassociateAddress() { |
| 158 | | - global $wgOut, $wgRequest; |
| 159 | | - |
| 160 | | - $this->setHeaders(); |
| 161 | | - $wgOut->setPagetitle( wfMsg( 'openstackmanager-disassociateaddress' ) ); |
| 162 | | - |
| 163 | | - $project = $wgRequest->getText( 'project' ); |
| 164 | | - $userCredentials = $this->userLDAP->getCredentials( $project ); |
| 165 | | - $this->userNova = new OpenStackNovaController( $userCredentials ); |
| 166 | | - $ip = $wgRequest->getText( 'ip' ); |
| 167 | | - if ( ! $wgRequest->wasPosted() ) { |
| 168 | | - $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-disassociateaddress-confirm', array(), $ip ) ); |
| 169 | | - $wgOut->addHTML( $out ); |
| 170 | | - } |
| 171 | | - $addressInfo = Array(); |
| 172 | | - $addressInfo['project'] = array( |
| 173 | | - 'type' => 'hidden', |
| 174 | | - 'default' => $project, |
| 175 | | - ); |
| 176 | | - $addressInfo['ip'] = array( |
| 177 | | - 'type' => 'hidden', |
| 178 | | - 'default' => $ip, |
| 179 | | - ); |
| 180 | | - $addressInfo['action'] = array( |
| 181 | | - 'type' => 'hidden', |
| 182 | | - 'default' => 'disassociate', |
| 183 | | - ); |
| 184 | | - $addressForm = new SpecialNovaAddressForm( $addressInfo, 'openstackmanager-novaaddress' ); |
| 185 | | - $addressForm->setTitle( SpecialPage::getTitleFor( 'NovaAddress' ) ); |
| 186 | | - $addressForm->setSubmitID( 'novaaddress-form-disassociateaddresssubmit' ); |
| 187 | | - $addressForm->setSubmitCallback( array( $this, 'tryDisassociateSubmit' ) ); |
| 188 | | - $addressForm->setSubmitText( 'confirm' ); |
| 189 | | - $addressForm->show(); |
| 190 | | - |
| 191 | | - } |
| 192 | | - |
| 193 | | - function listAddresses() { |
| 194 | | - global $wgOut, $wgUser; |
| 195 | | - |
| 196 | | - $this->setHeaders(); |
| 197 | | - $wgOut->setPagetitle( wfMsg( 'openstackmanager-addresslist' ) ); |
| 198 | | - |
| 199 | | - $userProjects = $this->userLDAP->getProjects(); |
| 200 | | - $out = ''; |
| 201 | | - $sk = $wgUser->getSkin(); |
| 202 | | - $header = Html::element( 'th', array(), wfMsg( 'openstackmanager-address' ) ); |
| 203 | | - $header .= Html::element( 'th', array(), wfMsg( 'openstackmanager-instanceid' ) ); |
| 204 | | - $header .= Html::element( 'th', array(), wfMsg( 'openstackmanager-instancename' ) ); |
| 205 | | - $header .= Html::element( 'th', array(), wfMsg( 'openstackmanager-actions' ) ); |
| 206 | | - $addresses = $this->adminNova->getAddresses(); |
| 207 | | - $projectArr = array(); |
| 208 | | - foreach ( $addresses as $address ) { |
| 209 | | - $ip = $address->getPublicIP(); |
| 210 | | - $instanceid = $address->getInstanceId(); |
| 211 | | - $project = $address->getProject(); |
| 212 | | - $addressOut = Html::element( 'td', array(), $ip ); |
| 213 | | - if ( $instanceid ) { |
| 214 | | - $addressOut .= Html::element( 'td', array(), $instanceid ); |
| 215 | | - $instance = $this->adminNova->getInstance( $instanceid ); |
| 216 | | - $instancename = $instance->getInstanceName(); |
| 217 | | - $addressOut .= Html::element( 'td', array(), $instancename ); |
| 218 | | - } else { |
| 219 | | - $addressOut .= Html::element( 'td', array(), '' ); |
| 220 | | - $addressOut .= Html::element( 'td', array(), '' ); |
| 221 | | - } |
| 222 | | - if ( $instanceid ) { |
| 223 | | - $msg = wfMsg( 'openstackmanager-reassociateaddress' ); |
| 224 | | - } else { |
| 225 | | - $msg = wfMsg( 'openstackmanager-releaseaddress' ); |
| 226 | | - $link = $sk->link( $this->getTitle(), $msg, array(), |
| 227 | | - array( 'action' => 'release', 'ip' => $ip, 'project' => $project ), array() ); |
| 228 | | - $actions = Html::rawElement( 'li', array(), $link ); |
| 229 | | - $msg = wfMsg( 'openstackmanager-associateaddress' ); |
| 230 | | - } |
| 231 | | - $link = $sk->link( $this->getTitle(), $msg, array(), |
| 232 | | - array( 'action' => 'associate', 'ip' => $ip, 'project' => $project ), array() ); |
| 233 | | - $actions .= Html::rawElement( 'li', array(), $link ); |
| 234 | | - if ( $instanceid ) { |
| 235 | | - $msg = wfMsg( 'openstackmanager-disassociateaddress' ); |
| 236 | | - $link = $sk->link( $this->getTitle(), $msg, array(), |
| 237 | | - array( 'action' => 'disassociate', 'ip' => $ip, 'project' => $project ), array() ); |
| 238 | | - $actions .= Html::rawElement( 'li', array(), $link ); |
| 239 | | - } |
| 240 | | - $actions = Html::rawElement( 'ul', array(), $actions ); |
| 241 | | - $addressOut .= Html::rawElement( 'td', array(), $actions ); |
| 242 | | - $projectArr["$project"] = Html::rawElement( 'tr', array(), $addressOut ); |
| 243 | | - } |
| 244 | | - foreach ( $userProjects as $project ) { |
| 245 | | - $out .= Html::element( 'h2', array(), $project ); |
| 246 | | - $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-allocateaddress' ), array(), array( 'action' => 'allocate', 'project' => $project ), array() ); |
| 247 | | - if ( isset( $projectArr["$project"] ) ) { |
| 248 | | - $projectOut = $header; |
| 249 | | - $projectOut .= $projectArr["$project"]; |
| 250 | | - $out .= Html::rawElement( 'table', |
| 251 | | - array( 'id' => 'novainstancelist', 'class' => 'wikitable' ), $projectOut ); |
| 252 | | - } |
| 253 | | - } |
| 254 | | - $wgOut->addHTML( $out ); |
| 255 | | - } |
| 256 | | - |
| 257 | | - function tryAllocateSubmit( $formData, $entryPoint = 'internal' ) { |
| 258 | | - global $wgOut, $wgUser; |
| 259 | | - |
| 260 | | - $address = $this->userNova->allocateAddress(); |
| 261 | | - if ( ! $address ) { |
| 262 | | - $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-allocateaddressfailed' ) ); |
| 263 | | - $wgOut->addHTML( $out ); |
| 264 | | - return false; |
| 265 | | - } |
| 266 | | - $ip = $address->getPublicIP(); |
| 267 | | - $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-allocatedaddress' , array(), $ip ) ); |
| 268 | | - $out .= '<br />'; |
| 269 | | - $sk = $wgUser->getSkin(); |
| 270 | | - $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backaddresslist' ), array(), array(), array() ); |
| 271 | | - $wgOut->addHTML( $out ); |
| 272 | | - |
| 273 | | - return true; |
| 274 | | - } |
| 275 | | - |
| 276 | | - function tryReleaseSubmit( $formData, $entryPoint = 'internal' ) { |
| 277 | | - global $wgOut, $wgUser; |
| 278 | | - |
| 279 | | - $ip = $formData['ip']; |
| 280 | | - $success = $this->userNova->releaseAddress( $ip ); |
| 281 | | - if ( $success ) { |
| 282 | | - $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-releasedaddress', array(), $ip ) ); |
| 283 | | - } else { |
| 284 | | - $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-releaseaddressfailed', array(), $ip ) ); |
| 285 | | - } |
| 286 | | - $out .= '<br />'; |
| 287 | | - $sk = $wgUser->getSkin(); |
| 288 | | - $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backaddresslist' ), array(), array(), array() ); |
| 289 | | - $wgOut->addHTML( $out ); |
| 290 | | - |
| 291 | | - return true; |
| 292 | | - } |
| 293 | | - |
| 294 | | - function tryAssociateSubmit( $formData, $entryPoint = 'internal' ) { |
| 295 | | - global $wgOut, $wgUser; |
| 296 | | - |
| 297 | | - $instanceid = $formData['instanceid']; |
| 298 | | - $ip = $formData['ip']; |
| 299 | | - $address = $this->userNova->associateAddress( $instanceid, $ip ); |
| 300 | | - if ( $address ) { |
| 301 | | - $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-associatedaddress', array(), $ip, $instanceid ) ); |
| 302 | | - } else { |
| 303 | | - $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-associateaddressfailed', array(), $ip, $instanceid ) ); |
| 304 | | - } |
| 305 | | - $out .= '<br />'; |
| 306 | | - $sk = $wgUser->getSkin(); |
| 307 | | - $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backaddresslist' ), array(), array(), array() ); |
| 308 | | - $wgOut->addHTML( $out ); |
| 309 | | - |
| 310 | | - return true; |
| 311 | | - } |
| 312 | | - |
| 313 | | - function tryDisassociateSubmit( $formData, $entryPoint = 'internal' ) { |
| 314 | | - global $wgOut, $wgUser; |
| 315 | | - |
| 316 | | - $ip = $formData['ip']; |
| 317 | | - $address = $this->userNova->disassociateAddress( $ip ); |
| 318 | | - if ( $address ) { |
| 319 | | - $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-disassociatedaddress', array(), $ip ) ); |
| 320 | | - } else { |
| 321 | | - $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-disassociateaddressfailed', array(), $ip ) ); |
| 322 | | - } |
| 323 | | - $out .= '<br />'; |
| 324 | | - $sk = $wgUser->getSkin(); |
| 325 | | - $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backaddresslist' ), array(), array(), array() ); |
| 326 | | - $wgOut->addHTML( $out ); |
| 327 | | - |
| 328 | | - return true; |
| 329 | | - } |
| 330 | | - |
| 331 | | -} |
| 332 | | - |
| 333 | | -class SpecialNovaAddressForm extends HTMLForm { |
| 334 | | -} |
| Index: trunk/extensions/OpenStackManager/SpecialNovaKey.php |
| — | — | @@ -1,241 +0,0 @@ |
| 2 | | -<?php |
| 3 | | -class SpecialNovaKey extends SpecialNova { |
| 4 | | - |
| 5 | | - var $userNova, $userLDAP; |
| 6 | | - |
| 7 | | - function __construct() { |
| 8 | | - parent::__construct( 'NovaKey' ); |
| 9 | | - } |
| 10 | | - |
| 11 | | - public function isRestricted() { |
| 12 | | - return true; |
| 13 | | - } |
| 14 | | - |
| 15 | | - function execute( $par ) { |
| 16 | | - global $wgRequest, $wgUser; |
| 17 | | - |
| 18 | | - if ( ! $wgUser->isLoggedIn() ) { |
| 19 | | - $this->notLoggedIn(); |
| 20 | | - return true; |
| 21 | | - } |
| 22 | | - $this->userLDAP = new OpenStackNovaUser(); |
| 23 | | - if ( ! $this->userLDAP->exists() ) { |
| 24 | | - $this->noCredentials(); |
| 25 | | - return true; |
| 26 | | - } |
| 27 | | - |
| 28 | | - $action = $wgRequest->getVal( 'action' ); |
| 29 | | - if ( $action == "import" ) { |
| 30 | | - $this->importKey(); |
| 31 | | - } else if ( $action == "delete" ) { |
| 32 | | - $this->deleteKey(); |
| 33 | | - } else { |
| 34 | | - $this->listKeys(); |
| 35 | | - } |
| 36 | | - } |
| 37 | | - |
| 38 | | - function importKey() { |
| 39 | | - global $wgRequest, $wgOut; |
| 40 | | - global $wgOpenStackManagerNovaKeypairStorage; |
| 41 | | - |
| 42 | | - if ( $wgOpenStackManagerNovaKeypairStorage == 'nova' ) { |
| 43 | | - $project = $wgRequest->getVal( 'project' ); |
| 44 | | - if ( $project && ! $this->userLDAP->inProject( $project ) ) { |
| 45 | | - $this->notInProject(); |
| 46 | | - return true; |
| 47 | | - } |
| 48 | | - $userCredentials = $this->userLDAP->getCredentials( $project ); |
| 49 | | - $this->userNova = new OpenStackNovaController( $userCredentials ); |
| 50 | | - } |
| 51 | | - |
| 52 | | - $this->setHeaders(); |
| 53 | | - $wgOut->setPagetitle( wfMsg( 'openstackmanager-importkey' ) ); |
| 54 | | - |
| 55 | | - $keyInfo = Array(); |
| 56 | | - |
| 57 | | - if ( $wgOpenStackManagerNovaKeypairStorage == 'nova' ) { |
| 58 | | - $keyInfo['keyname'] = array( |
| 59 | | - 'type' => 'text', |
| 60 | | - 'label-message' => 'openstackmanager-keyname', |
| 61 | | - 'default' => '', |
| 62 | | - 'section' => 'key/info', |
| 63 | | - ); |
| 64 | | - } |
| 65 | | - |
| 66 | | - $keyInfo['key'] = array( |
| 67 | | - 'type' => 'textarea', |
| 68 | | - 'section' => 'key/info', |
| 69 | | - 'default' => '', |
| 70 | | - 'label-message' => 'openstackmanager-key', |
| 71 | | - ); |
| 72 | | - |
| 73 | | - $keyInfo['action'] = array( |
| 74 | | - 'type' => 'hidden', |
| 75 | | - 'default' => 'import', |
| 76 | | - ); |
| 77 | | - |
| 78 | | - $keyInfo['project'] = array( |
| 79 | | - 'type' => 'hidden', |
| 80 | | - 'default' => htmlentities( $project ), |
| 81 | | - ); |
| 82 | | - |
| 83 | | - $keyForm = new SpecialNovaKeyForm( $keyInfo, 'openstackmanager-novakey' ); |
| 84 | | - $keyForm->setTitle( SpecialPage::getTitleFor( 'NovaKey' ) ); |
| 85 | | - $keyForm->setSubmitID( 'novakey-form-createkeysubmit' ); |
| 86 | | - $keyForm->setSubmitCallback( array( $this, 'tryImportSubmit' ) ); |
| 87 | | - $keyForm->show(); |
| 88 | | - |
| 89 | | - } |
| 90 | | - |
| 91 | | - function deleteKey() { |
| 92 | | - global $wgOut, $wgRequest; |
| 93 | | - global $wgOpenStackManagerNovaKeypairStorage; |
| 94 | | - |
| 95 | | - $this->setHeaders(); |
| 96 | | - $wgOut->setPagetitle( wfMsg( 'openstackmanager-deletekey' ) ); |
| 97 | | - |
| 98 | | - $keyInfo = Array(); |
| 99 | | - |
| 100 | | - if ( $wgOpenStackManagerNovaKeypairStorage == 'nova' ) { |
| 101 | | - $keyname = $wgRequest->getVal( 'keyname' ); |
| 102 | | - $project = $wgRequest->getVal( 'project' ); |
| 103 | | - if ( $project && ! $this->userLDAP->inProject( $project ) ) { |
| 104 | | - $this->notInProject(); |
| 105 | | - return true; |
| 106 | | - } |
| 107 | | - $keyInfo['keyname'] = array( |
| 108 | | - 'type' => 'hidden', |
| 109 | | - 'default' => $project, |
| 110 | | - ); |
| 111 | | - $keyInfo['project'] = array( |
| 112 | | - 'type' => 'hidden', |
| 113 | | - 'default' => $keyname, |
| 114 | | - ); |
| 115 | | - } else if ( $wgOpenStackManagerNovaKeypairStorage == 'ldap' ) { |
| 116 | | - $hash = $wgRequest->getVal( 'hash' ); |
| 117 | | - $keypairs = $this->userLDAP->getKeypairs(); |
| 118 | | - if ( ! $wgRequest->wasPosted() ) { |
| 119 | | - $out = Html::element( 'pre', array(), $keypairs[$hash] ); |
| 120 | | - $out .= Html::element( 'p', array(), wfMsg( 'openstackmanager-deletekeyconfirm' ) ); |
| 121 | | - $wgOut->addHTML( $out ); |
| 122 | | - } |
| 123 | | - $keyInfo['hash'] = array( |
| 124 | | - 'type' => 'hidden', |
| 125 | | - 'default' => $hash, |
| 126 | | - ); |
| 127 | | - } |
| 128 | | - $keyInfo['key'] = array( |
| 129 | | - 'type' => 'hidden', |
| 130 | | - 'default' => $keypairs[$hash], |
| 131 | | - ); |
| 132 | | - $keyInfo['action'] = array( |
| 133 | | - 'type' => 'hidden', |
| 134 | | - 'default' => 'delete', |
| 135 | | - ); |
| 136 | | - $keyForm = new SpecialNovaKeyForm( $keyInfo, 'openstackmanager-novakey' ); |
| 137 | | - $keyForm->setTitle( SpecialPage::getTitleFor( 'NovaKey' ) ); |
| 138 | | - $keyForm->setSubmitID( 'novakey-form-deletekeysubmit' ); |
| 139 | | - $keyForm->setSubmitCallback( array( $this, 'tryDeleteSubmit' ) ); |
| 140 | | - $keyForm->setSubmitText( 'confirm' ); |
| 141 | | - $keyForm->show(); |
| 142 | | - return true; |
| 143 | | - } |
| 144 | | - |
| 145 | | - function listKeys() { |
| 146 | | - global $wgOut, $wgUser; |
| 147 | | - global $wgOpenStackManagerNovaKeypairStorage; |
| 148 | | - |
| 149 | | - $this->setHeaders(); |
| 150 | | - $wgOut->setPagetitle( wfMsg( 'openstackmanager-keylist' ) ); |
| 151 | | - |
| 152 | | - $out = ''; |
| 153 | | - $sk = $wgUser->getSkin(); |
| 154 | | - if ( $wgOpenStackManagerNovaKeypairStorage == 'nova' ) { |
| 155 | | - $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-importkey' ), array(), array( 'action' => 'import' ), array() ); |
| 156 | | - $projects = $this->userLDAP->getProjects(); |
| 157 | | - foreach ( $projects as $project ) { |
| 158 | | - $userCredentials = $this->userLDAP->getCredentials( $project ); |
| 159 | | - $this->userNova = new OpenStackNovaController( $userCredentials ); |
| 160 | | - $keypairs = $this->userNova->getKeypairs(); |
| 161 | | - if ( ! $keypairs ) { |
| 162 | | - continue; |
| 163 | | - } |
| 164 | | - $out .= Html::element( 'h2', array(), $project ); |
| 165 | | - $projectOut = Html::element( 'th', array(), wfMsg( 'openstackmanager-name' ) ); |
| 166 | | - $projectOut .= Html::element( 'th', array(), wfMsg( 'openstackmanager-fingerprint' ) ); |
| 167 | | - foreach ( $keypairs as $keypair ) { |
| 168 | | - $keyOut = Html::element( 'td', array(), $keypair->getKeyName() ); |
| 169 | | - $keyOut .= Html::element( 'td', array(), $keypair->getKeyFingerprint() ); |
| 170 | | - $projectOut .= Html::rawElement( 'tr', array(), $keyOut ); |
| 171 | | - } |
| 172 | | - $out .= Html::rawElement( 'table', array( 'id' => 'novakeylist', 'class' => 'wikitable' ), $projectOut ); |
| 173 | | - } |
| 174 | | - } else if ( $wgOpenStackManagerNovaKeypairStorage == 'ldap' ) { |
| 175 | | - $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-importkey' ), array(), array( 'action' => 'import' ), array() ); |
| 176 | | - $keypairs = $this->userLDAP->getKeypairs(); |
| 177 | | - $keysOut = ''; |
| 178 | | - foreach ( $keypairs as $hash => $key ) { |
| 179 | | - $keyOut = Html::element( 'td', array(), $key ); |
| 180 | | - $msg = wfMsg( 'openstackmanager-delete' ); |
| 181 | | - $link = $sk->link( $this->getTitle(), $msg, array(), array( 'action' => 'delete', 'hash' => $hash ), array() ); |
| 182 | | - $keyOut .= Html::rawElement( 'td', array(), $link ); |
| 183 | | - $keysOut .= Html::rawElement( 'tr', array(), $keyOut ); |
| 184 | | - } |
| 185 | | - $out .= Html::rawElement( 'table', array(), $keysOut ); |
| 186 | | - } else { |
| 187 | | - $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-invalidkeypair' ) ); |
| 188 | | - } |
| 189 | | - |
| 190 | | - $wgOut->addHTML( $out ); |
| 191 | | - } |
| 192 | | - |
| 193 | | - function tryImportSubmit( $formData, $entryPoint = 'internal' ) { |
| 194 | | - global $wgOut, $wgUser; |
| 195 | | - global $wgOpenStackManagerNovaKeypairStorage; |
| 196 | | - |
| 197 | | - if ( $wgOpenStackManagerNovaKeypairStorage == 'ldap' ) { |
| 198 | | - $success = $this->userLDAP->importKeypair( $formData['key'] ); |
| 199 | | - if ( ! $success ) { |
| 200 | | - $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-keypairimportfailed' ) ); |
| 201 | | - $wgOut->addHTML( $out ); |
| 202 | | - return false; |
| 203 | | - } |
| 204 | | - $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-keypairimported' ) ); |
| 205 | | - } else if ( $wgOpenStackManagerNovaKeypairStorage == 'nova' ) { |
| 206 | | - # wgOpenStackManagerNovaKeypairStorage == 'nova' |
| 207 | | - # OpenStack's EC2 API doesn't yet support importing keys, use |
| 208 | | - # of this option isn't currently recommended |
| 209 | | - $keypair = $this->userNova->importKeypair( $formData['keyname'], $formData['key'] ); |
| 210 | | - |
| 211 | | - $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-keypairimportedfingerprint', array(), |
| 212 | | - $keypair->getKeyName(), $keypair->getKeyFingerprint() ) ); |
| 213 | | - } else { |
| 214 | | - $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-invalidkeypair' ) ); |
| 215 | | - } |
| 216 | | - $out .= '<br />'; |
| 217 | | - $sk = $wgUser->getSkin(); |
| 218 | | - $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backkeylist' ), array(), array(), array() ); |
| 219 | | - $wgOut->addHTML( $out ); |
| 220 | | - return true; |
| 221 | | - } |
| 222 | | - |
| 223 | | - function tryDeleteSubmit( $formData, $entryPoint = 'internal' ) { |
| 224 | | - global $wgOut, $wgUser; |
| 225 | | - global $wgOpenStackManagerNovaKeypairStorage; |
| 226 | | - |
| 227 | | - $success = $this->userLDAP->deleteKeypair( $formData['key'] ); |
| 228 | | - if ( $success ) { |
| 229 | | - $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-deletedkey' ) ); |
| 230 | | - } else { |
| 231 | | - $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-deletedkeyfailed' ) ); |
| 232 | | - } |
| 233 | | - $out .= '<br />'; |
| 234 | | - $sk = $wgUser->getSkin(); |
| 235 | | - $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backkeylist' ), array(), array(), array() ); |
| 236 | | - $wgOut->addHTML( $out ); |
| 237 | | - return true; |
| 238 | | - } |
| 239 | | -} |
| 240 | | - |
| 241 | | -class SpecialNovaKeyForm extends HTMLForm { |
| 242 | | -} |
| Index: trunk/extensions/OpenStackManager/special/SpecialNovaInstance.php |
| — | — | @@ -0,0 +1,495 @@ |
| | 2 | +<?php |
| | 3 | +class SpecialNovaInstance extends SpecialNova { |
| | 4 | + |
| | 5 | + var $adminNova, $userNova; |
| | 6 | + var $userLDAP; |
| | 7 | + |
| | 8 | + function __construct() { |
| | 9 | + parent::__construct( 'NovaInstance' ); |
| | 10 | + } |
| | 11 | + |
| | 12 | + function execute( $par ) { |
| | 13 | + global $wgRequest, $wgUser; |
| | 14 | + global $wgOpenStackManagerNovaAdminKeys; |
| | 15 | + |
| | 16 | + if ( ! $wgUser->isLoggedIn() ) { |
| | 17 | + $this->notLoggedIn(); |
| | 18 | + return true; |
| | 19 | + } |
| | 20 | + $user = new OpenStackNovaUser(); |
| | 21 | + if ( ! $user->exists() ) { |
| | 22 | + $this->noCredentials(); |
| | 23 | + return true; |
| | 24 | + } |
| | 25 | + $this->userLDAP = new OpenStackNovaUser(); |
| | 26 | + $project = $wgRequest->getVal( 'project' ); |
| | 27 | + $userCredentials = $user->getCredentials( $project ); |
| | 28 | + $this->userNova = new OpenStackNovaController( $userCredentials ); |
| | 29 | + $adminCredentials = $wgOpenStackManagerNovaAdminKeys; |
| | 30 | + $this->adminNova = new OpenStackNovaController( $adminCredentials ); |
| | 31 | + |
| | 32 | + $action = $wgRequest->getVal( 'action' ); |
| | 33 | + |
| | 34 | + if ( $action == "create" ) { |
| | 35 | + if ( ! $user->inProject( $project ) ) { |
| | 36 | + $this->notInProject(); |
| | 37 | + return true; |
| | 38 | + } |
| | 39 | + $this->createInstance(); |
| | 40 | + } else if ( $action == "delete" ) { |
| | 41 | + if ( ! $user->inProject( $project ) ) { |
| | 42 | + $this->notInProject(); |
| | 43 | + return true; |
| | 44 | + } |
| | 45 | + $this->deleteInstance(); |
| | 46 | + } else if ( $action == "rename" ) { |
| | 47 | + if ( ! $user->inProject( $project ) ) { |
| | 48 | + $this->notInProject(); |
| | 49 | + return true; |
| | 50 | + } |
| | 51 | + $this->renameInstance(); |
| | 52 | + } else if ( $action == "configure" ) { |
| | 53 | + if ( ! $user->inProject( $project ) ) { |
| | 54 | + $this->notInProject(); |
| | 55 | + return true; |
| | 56 | + } |
| | 57 | + $this->configureInstance(); |
| | 58 | + } else { |
| | 59 | + $this->listInstances(); |
| | 60 | + } |
| | 61 | + } |
| | 62 | + |
| | 63 | + function createInstance() { |
| | 64 | + global $wgRequest, $wgOut; |
| | 65 | + global $wgOpenStackManagerPuppetOptions; |
| | 66 | + |
| | 67 | + $this->setHeaders(); |
| | 68 | + $wgOut->setPagetitle( wfMsg( 'openstackmanager-createinstance' ) ); |
| | 69 | + |
| | 70 | + $instanceInfo = Array(); |
| | 71 | + $instanceInfo['instancename'] = array( |
| | 72 | + 'type' => 'text', |
| | 73 | + 'label-message' => 'openstackmanager-instancename', |
| | 74 | + 'validation-callback' => array( $this, 'validateInstanceName' ), |
| | 75 | + 'default' => '', |
| | 76 | + 'section' => 'instance/info', |
| | 77 | + ); |
| | 78 | + |
| | 79 | + $instanceTypes = $this->adminNova->getInstanceTypes(); |
| | 80 | + $instanceType_keys = Array(); |
| | 81 | + foreach ( $instanceTypes as $instanceType ) { |
| | 82 | + $instanceType_keys["$instanceType"] = $instanceType; |
| | 83 | + } |
| | 84 | + $instanceInfo['instanceType'] = array( |
| | 85 | + 'type' => 'select', |
| | 86 | + 'label-message' => 'openstackmanager-instancetype', |
| | 87 | + 'section' => 'instance/info', |
| | 88 | + 'options' => $instanceType_keys, |
| | 89 | + ); |
| | 90 | + |
| | 91 | + # Availability zone names can't be translated. Get the keys, and make an array |
| | 92 | + # where the name points to itself as a value |
| | 93 | + $availabilityZones = $this->adminNova->getAvailabilityZones(); |
| | 94 | + $availabilityZone_keys = Array(); |
| | 95 | + foreach ( array_keys( $availabilityZones ) as $availabilityZone_key ) { |
| | 96 | + $availabilityZone_keys["$availabilityZone_key"] = $availabilityZone_key; |
| | 97 | + } |
| | 98 | + $instanceInfo['availabilityZone'] = array( |
| | 99 | + 'type' => 'select', |
| | 100 | + 'section' => 'instance/info', |
| | 101 | + 'options' => $availabilityZone_keys, |
| | 102 | + 'label-message' => 'openstackmanager-availabilityzone', |
| | 103 | + ); |
| | 104 | + |
| | 105 | + # Image names can't be translated. Get the image, and make an array |
| | 106 | + # where the name points to itself as a value |
| | 107 | + $images = $this->adminNova->getImages(); |
| | 108 | + $image_keys = Array(); |
| | 109 | + foreach ( array_keys( $images ) as $image_key ) { |
| | 110 | + $image_keys["$image_key"] = $image_key; |
| | 111 | + } |
| | 112 | + $instanceInfo['imageType'] = array( |
| | 113 | + 'type' => 'select', |
| | 114 | + 'section' => 'instance/info', |
| | 115 | + 'options' => $image_keys, |
| | 116 | + 'label-message' => 'openstackmanager-imagetype', |
| | 117 | + ); |
| | 118 | + |
| | 119 | + # Keypair names can't be translated. Get the keys, and make an array |
| | 120 | + # where the name points to itself as a value |
| | 121 | + # TODO: get keypairs as the user, not the admin |
| | 122 | + # $keypairs = $this->userNova->getKeypairs(); |
| | 123 | + # $keypair_keys = Array(); |
| | 124 | + # foreach ( array_keys( $keypairs ) as $keypair_key ) { |
| | 125 | + # $keypair_keys["$keypair_key"] = $keypair_key; |
| | 126 | + # } |
| | 127 | + # $instanceInfo['keypair'] = array( |
| | 128 | + # 'type' => 'select', |
| | 129 | + # 'section' => 'instance/info', |
| | 130 | + # 'options' => $keypair_keys, |
| | 131 | + # 'label-message' => 'keypair', |
| | 132 | + # ); |
| | 133 | + |
| | 134 | + $domains = OpenStackNovaDomain::getAllDomains( true ); |
| | 135 | + $domain_keys = array(); |
| | 136 | + foreach ( $domains as $domain ) { |
| | 137 | + $domainname = $domain->getDomainName(); |
| | 138 | + $domain_keys["$domainname"] = $domainname; |
| | 139 | + } |
| | 140 | + $instanceInfo['domain'] = array( |
| | 141 | + 'type' => 'select', |
| | 142 | + 'section' => 'instance/info', |
| | 143 | + 'options' => $domain_keys, |
| | 144 | + 'label-message' => 'openstackmanager-dnsdomain', |
| | 145 | + ); |
| | 146 | + |
| | 147 | + $instanceInfo['project'] = array( |
| | 148 | + 'type' => 'hidden', |
| | 149 | + 'default' => $wgRequest->getText( 'project' ), |
| | 150 | + ); |
| | 151 | + |
| | 152 | + if ( $wgOpenStackManagerPuppetOptions['enabled'] ) { |
| | 153 | + if ( $wgOpenStackManagerPuppetOptions['availableclasses'] ) { |
| | 154 | + $classes = array(); |
| | 155 | + foreach ( $wgOpenStackManagerPuppetOptions['availableclasses'] as $class ) { |
| | 156 | + $classes["$class"] = $class; |
| | 157 | + } |
| | 158 | + $instanceInfo['puppetclasses'] = array( |
| | 159 | + 'type' => 'multiselect', |
| | 160 | + 'section' => 'instance/puppetinfo', |
| | 161 | + 'options' => $classes, |
| | 162 | + 'label-message' => 'openstackmanager-puppetclasses', |
| | 163 | + ); |
| | 164 | + } |
| | 165 | + |
| | 166 | + if ( $wgOpenStackManagerPuppetOptions['availablevariables'] ) { |
| | 167 | + foreach ( $wgOpenStackManagerPuppetOptions['availablevariables'] as $variable ) { |
| | 168 | + $instanceInfo["$variable"] = array( |
| | 169 | + 'type' => 'text', |
| | 170 | + 'section' => 'instance/puppetinfo', |
| | 171 | + 'label' => $variable, |
| | 172 | + ); |
| | 173 | + } |
| | 174 | + } |
| | 175 | + } |
| | 176 | + |
| | 177 | + $instanceInfo['action'] = array( |
| | 178 | + 'type' => 'hidden', |
| | 179 | + 'default' => 'create', |
| | 180 | + ); |
| | 181 | + |
| | 182 | + $instanceForm = new SpecialNovaInstanceForm( $instanceInfo, 'openstackmanager-novainstance' ); |
| | 183 | + $instanceForm->setTitle( SpecialPage::getTitleFor( 'NovaInstance' ) ); |
| | 184 | + $instanceForm->setSubmitID( 'openstackmanager-novainstance-createinstancesubmit' ); |
| | 185 | + $instanceForm->setSubmitCallback( array( $this, 'tryCreateSubmit' ) ); |
| | 186 | + $instanceForm->show(); |
| | 187 | + |
| | 188 | + } |
| | 189 | + |
| | 190 | + function configureInstance() { |
| | 191 | + global $wgRequest, $wgOut; |
| | 192 | + global $wgOpenStackManagerPuppetOptions; |
| | 193 | + |
| | 194 | + $this->setHeaders(); |
| | 195 | + $wgOut->setPagetitle( wfMsg( 'openstackmanager-configureinstance' ) ); |
| | 196 | + |
| | 197 | + $instanceid = $wgRequest->getText( 'instanceid' ); |
| | 198 | + |
| | 199 | + $instanceInfo = Array(); |
| | 200 | + $instanceInfo['instanceid'] = array( |
| | 201 | + 'type' => 'hidden', |
| | 202 | + 'default' => $instanceid, |
| | 203 | + ); |
| | 204 | + $instanceInfo['project'] = array( |
| | 205 | + 'type' => 'hidden', |
| | 206 | + 'default' => $wgRequest->getText( 'project' ), |
| | 207 | + ); |
| | 208 | + |
| | 209 | + if ( $wgOpenStackManagerPuppetOptions['enabled'] ) { |
| | 210 | + $host = OpenStackNovaHost::getHostByInstanceId( $instanceid ); |
| | 211 | + if ( ! $host ) { |
| | 212 | + $wgOut->addHTML( Html::element( 'p', array(), wfMsg( 'openstackmanager-nonexistanthost' ) ) ); |
| | 213 | + return false; |
| | 214 | + } |
| | 215 | + $puppetinfo = $host->getPuppetConfiguration(); |
| | 216 | + |
| | 217 | + if ( $wgOpenStackManagerPuppetOptions['availableclasses'] ) { |
| | 218 | + $classes = array(); |
| | 219 | + $defaults = array(); |
| | 220 | + foreach ( $wgOpenStackManagerPuppetOptions['availableclasses'] as $class ) { |
| | 221 | + $classes["$class"] = $class; |
| | 222 | + if ( in_array( $class, $puppetinfo['puppetclass'] ) ) { |
| | 223 | + $defaults["$class"] = $class; |
| | 224 | + } |
| | 225 | + } |
| | 226 | + $instanceInfo['puppetclasses'] = array( |
| | 227 | + 'type' => 'multiselect', |
| | 228 | + 'section' => 'instance/puppetinfo', |
| | 229 | + 'options' => $classes, |
| | 230 | + 'default' => $defaults, |
| | 231 | + 'label-message' => 'openstackmanager-puppetclasses', |
| | 232 | + ); |
| | 233 | + } |
| | 234 | + |
| | 235 | + if ( $wgOpenStackManagerPuppetOptions['availablevariables'] ) { |
| | 236 | + foreach ( $wgOpenStackManagerPuppetOptions['availablevariables'] as $variable ) { |
| | 237 | + $default = ''; |
| | 238 | + if ( array_key_exists( $variable, $puppetinfo['puppetvar'] ) ) { |
| | 239 | + $default = $puppetinfo['puppetvar']["$variable"]; |
| | 240 | + } |
| | 241 | + $instanceInfo["$variable"] = array( |
| | 242 | + 'type' => 'text', |
| | 243 | + 'section' => 'instance/puppetinfo', |
| | 244 | + 'label' => $variable, |
| | 245 | + 'default' => $default, |
| | 246 | + ); |
| | 247 | + } |
| | 248 | + } |
| | 249 | + } |
| | 250 | + |
| | 251 | + $instanceInfo['action'] = array( |
| | 252 | + 'type' => 'hidden', |
| | 253 | + 'default' => 'configure', |
| | 254 | + ); |
| | 255 | + |
| | 256 | + $instanceForm = new SpecialNovaInstanceForm( $instanceInfo, 'openstackmanager-novainstance' ); |
| | 257 | + $instanceForm->setTitle( SpecialPage::getTitleFor( 'NovaInstance' ) ); |
| | 258 | + $instanceForm->setSubmitID( 'novainstance-form-configureinstancesubmit' ); |
| | 259 | + $instanceForm->setSubmitCallback( array( $this, 'tryConfigureSubmit' ) ); |
| | 260 | + $instanceForm->show(); |
| | 261 | + |
| | 262 | + return true; |
| | 263 | + } |
| | 264 | + |
| | 265 | + function deleteInstance() { |
| | 266 | + global $wgOut, $wgRequest; |
| | 267 | + |
| | 268 | + $this->setHeaders(); |
| | 269 | + $wgOut->setPagetitle( wfMsg( 'openstackmanager-deletedomain' ) ); |
| | 270 | + |
| | 271 | + $instanceid = $wgRequest->getText( 'instanceid' ); |
| | 272 | + $project = $wgRequest->getText( 'project' ); |
| | 273 | + if ( ! $wgRequest->wasPosted() ) { |
| | 274 | + $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-deleteinstancequestion', array(), $instanceid ) ); |
| | 275 | + $wgOut->addHTML( $out ); |
| | 276 | + } |
| | 277 | + $instanceInfo = Array(); |
| | 278 | + $instanceInfo['instanceid'] = array( |
| | 279 | + 'type' => 'hidden', |
| | 280 | + 'default' => $instanceid, |
| | 281 | + ); |
| | 282 | + $instanceInfo['project'] = array( |
| | 283 | + 'type' => 'hidden', |
| | 284 | + 'default' => $project, |
| | 285 | + ); |
| | 286 | + $instanceInfo['action'] = array( |
| | 287 | + 'type' => 'hidden', |
| | 288 | + 'default' => 'delete', |
| | 289 | + ); |
| | 290 | + $instanceForm = new SpecialNovaInstanceForm( $instanceInfo, 'openstackmanager-novainstance' ); |
| | 291 | + $instanceForm->setTitle( SpecialPage::getTitleFor( 'NovaInstance' ) ); |
| | 292 | + $instanceForm->setSubmitID( 'novainstance-form-deleteinstancesubmit' ); |
| | 293 | + $instanceForm->setSubmitCallback( array( $this, 'tryDeleteSubmit' ) ); |
| | 294 | + $instanceForm->setSubmitText( 'confirm' ); |
| | 295 | + $instanceForm->show(); |
| | 296 | + |
| | 297 | + return true; |
| | 298 | + } |
| | 299 | + |
| | 300 | + function modifyInstance() { |
| | 301 | + return true; |
| | 302 | + } |
| | 303 | + |
| | 304 | + function listInstances() { |
| | 305 | + global $wgOut, $wgUser; |
| | 306 | + |
| | 307 | + $this->setHeaders(); |
| | 308 | + $wgOut->setPagetitle( wfMsg( 'openstackmanager-instancelist' ) ); |
| | 309 | + |
| | 310 | + $userProjects = $this->userLDAP->getProjects(); |
| | 311 | + $sk = $wgUser->getSkin(); |
| | 312 | + $out = ''; |
| | 313 | + $instances = $this->adminNova->getInstances(); |
| | 314 | + $header = Html::element( 'th', array(), wfMsg( 'openstackmanager-instancename' ) ); |
| | 315 | + $header .= Html::element( 'th', array(), wfMsg( 'openstackmanager-instanceid' ) ); |
| | 316 | + $header .= Html::element( 'th', array(), wfMsg( 'openstackmanager-instancestate' ) ); |
| | 317 | + $header .= Html::element( 'th', array(), wfMsg( 'openstackmanager-instancetype' ) ); |
| | 318 | + $header .= Html::element( 'th', array(), wfMsg( 'openstackmanager-instanceip' ) ); |
| | 319 | + $header .= Html::element( 'th', array(), wfMsg( 'openstackmanager-imageid' ) ); |
| | 320 | + $header .= Html::element( 'th', array(), wfMsg( 'openstackmanager-actions' ) ); |
| | 321 | + $projectArr = array(); |
| | 322 | + foreach ( $instances as $instance ) { |
| | 323 | + $project = $instance->getOwner(); |
| | 324 | + if ( ! in_array( $project, $userProjects ) ) { |
| | 325 | + continue; |
| | 326 | + } |
| | 327 | + $instanceName = (string)$instance->getInstanceName(); |
| | 328 | + $title = Title::newFromText( $instanceName, NS_VM ); |
| | 329 | + $instanceNameLink = $sk->link( $title, $instanceName, array(), array(), array() ); |
| | 330 | + $instanceOut = Html::rawElement( 'td', array(), $instanceNameLink ); |
| | 331 | + $instanceOut .= Html::element( 'td', array(), $instance->getInstanceId() ); |
| | 332 | + $instanceOut .= Html::element( 'td', array(), $instance->getInstanceState() ); |
| | 333 | + $instanceOut .= Html::element( 'td', array(), $instance->getInstanceType() ); |
| | 334 | + $instanceOut .= Html::element( 'td', array(), $instance->getInstancePrivateIP() ); |
| | 335 | + $instanceOut .= Html::element( 'td', array(), $instance->getImageId() ); |
| | 336 | + $msg = wfMsg( 'openstackmanager-delete' ); |
| | 337 | + $actions = $sk->link( $this->getTitle(), $msg, array(), |
| | 338 | + array( 'action' => 'delete', |
| | 339 | + 'project' => $project, |
| | 340 | + 'instanceid' => $instance->getInstanceId() ), |
| | 341 | + array() ); |
| | 342 | + $actions .= ', '; |
| | 343 | + $msg = wfMsg( 'openstackmanager-rename' ); |
| | 344 | + $actions .= $sk->link( $this->getTitle(), $msg, array(), |
| | 345 | + array( 'action' => 'rename', |
| | 346 | + 'project' => $project, |
| | 347 | + 'instanceid' => $instance->getInstanceId() ), |
| | 348 | + array() ); |
| | 349 | + $actions .= ', '; |
| | 350 | + $msg = wfMsg( 'openstackmanager-configure' ); |
| | 351 | + $actions .= $sk->link( $this->getTitle(), $msg, array(), |
| | 352 | + array( 'action' => 'configure', |
| | 353 | + 'project' => $project, |
| | 354 | + 'instanceid' => $instance->getInstanceId() ), |
| | 355 | + array() ); |
| | 356 | + $instanceOut .= Html::rawElement( 'td', array(), $actions ); |
| | 357 | + $projectArr["$project"] .= Html::rawElement( 'tr', array(), $instanceOut ); |
| | 358 | + } |
| | 359 | + foreach ( $userProjects as $project ) { |
| | 360 | + $out .= Html::element( 'h2', array(), $project ); |
| | 361 | + $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-createinstance' ), array(), |
| | 362 | + array( 'action' => 'create', 'project' => $project ), array() ); |
| | 363 | + if ( isset( $projectArr["$project"] ) ) { |
| | 364 | + $projectOut = $header; |
| | 365 | + $projectOut .= $projectArr["$project"]; |
| | 366 | + $out .= Html::rawElement( 'table', |
| | 367 | + array( 'id' => 'novainstancelist', 'class' => 'wikitable' ), $projectOut ); |
| | 368 | + } |
| | 369 | + } |
| | 370 | + |
| | 371 | + $wgOut->addHTML( $out ); |
| | 372 | + } |
| | 373 | + |
| | 374 | + function tryCreateSubmit( $formData, $entryPoint = 'internal' ) { |
| | 375 | + global $wgOut, $wgUser; |
| | 376 | + global $wgOpenStackManagerPuppetOptions; |
| | 377 | + |
| | 378 | + $sk = $wgUser->getSkin(); |
| | 379 | + $domain = OpenStackNovaDomain::getDomainByName( $formData['domain'] ); |
| | 380 | + if ( ! $domain ) { |
| | 381 | + $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-invaliddomain' ) ); |
| | 382 | + return false; |
| | 383 | + } |
| | 384 | + $instance = $this->userNova->createInstance( $formData['instancename'], $formData['imageType'], '', $formData['instanceType'], $formData['availabilityZone'] ); |
| | 385 | + if ( $instance ) { |
| | 386 | + $puppetinfo = array(); |
| | 387 | + if ( $wgOpenStackManagerPuppetOptions['enabled'] ) { |
| | 388 | + foreach ( $formData['puppetclasses'] as $class ) { |
| | 389 | + if ( in_array( $class, $wgOpenStackManagerPuppetOptions['availableclasses'] ) ) { |
| | 390 | + $puppetinfo['classes'][] = $class; |
| | 391 | + } |
| | 392 | + } |
| | 393 | + foreach ( $wgOpenStackManagerPuppetOptions['availablevariables'] as $variable ) { |
| | 394 | + if ( isset ( $formData["$variable"] ) ) { |
| | 395 | + $puppetinfo['variables']["$variable"] = $formData["$variable"]; |
| | 396 | + } |
| | 397 | + } |
| | 398 | + } |
| | 399 | + $host = OpenStackNovaHost::addHost( $instance, $domain, $puppetinfo ); |
| | 400 | + |
| | 401 | + if ( $host ) { |
| | 402 | + $title = Title::newFromText( $wgOut->getPageTitle() ); |
| | 403 | + $job = new OpenStackNovaHostJob( $title, array( 'instanceid' => (string)$instance->getInstanceId() ) ); |
| | 404 | + $job->insert(); |
| | 405 | + $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-createdinstance', array(), |
| | 406 | + $instance->getInstanceID(), $instance->getImageId(), |
| | 407 | + $host->getFullyQualifiedHostName() ) ); |
| | 408 | + } else { |
| | 409 | + $this->userNova->terminateInstance( $instance->getInstanceId() ); |
| | 410 | + $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-createfailedldap' ) ); |
| | 411 | + } |
| | 412 | + # TODO: also add puppet |
| | 413 | + } else { |
| | 414 | + $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-createinstancefailed' ) ); |
| | 415 | + } |
| | 416 | + $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backinstancelist' ), array(), array(), array() ); |
| | 417 | + |
| | 418 | + $wgOut->addHTML( $out ); |
| | 419 | + return true; |
| | 420 | + } |
| | 421 | + |
| | 422 | + function tryDeleteSubmit( $formData, $entryPoint = 'internal' ) { |
| | 423 | + global $wgOut, $wgUser; |
| | 424 | + |
| | 425 | + $sk = $wgUser->getSkin(); |
| | 426 | + $instance = $this->adminNova->getInstance( $formData['instanceid'] ); |
| | 427 | + if ( ! $instance ) { |
| | 428 | + $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-nonexistanthost' ) ); |
| | 429 | + return true; |
| | 430 | + } |
| | 431 | + $instancename = $instance->getInstanceName(); |
| | 432 | + $instanceid = $instance->getInstanceId(); |
| | 433 | + $success = $this->userNova->terminateInstance( $instanceid ); |
| | 434 | + if ( $success ) { |
| | 435 | + $success = OpenStackNovaHost::deleteHostByInstanceId( $instanceid ); |
| | 436 | + if ( $success ) { |
| | 437 | + $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-deletedinstance', array(), $instanceid ) ); |
| | 438 | + } else { |
| | 439 | + $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-deletedinstance-faileddns', array(), $instancename, $instanceid ) ); |
| | 440 | + } |
| | 441 | + } else { |
| | 442 | + $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-deleteinstancefailed' ) ); |
| | 443 | + } |
| | 444 | + $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backinstancelist' ), array(), array(), array() ); |
| | 445 | + |
| | 446 | + $wgOut->addHTML( $out ); |
| | 447 | + return true; |
| | 448 | + } |
| | 449 | + |
| | 450 | + function tryConfigureSubmit( $formData, $entryPoint = 'internal' ) { |
| | 451 | + global $wgOut, $wgUser; |
| | 452 | + global $wgOpenStackManagerPuppetOptions; |
| | 453 | + |
| | 454 | + $sk = $wgUser->getSkin(); |
| | 455 | + $host = OpenStackNovaHost::getHostByInstanceId( $formData['instanceid'] ); |
| | 456 | + if ( $host ) { |
| | 457 | + $puppetinfo = array(); |
| | 458 | + if ( $wgOpenStackManagerPuppetOptions['enabled'] ) { |
| | 459 | + foreach ( $formData['puppetclasses'] as $class ) { |
| | 460 | + if ( in_array( $class, $wgOpenStackManagerPuppetOptions['availableclasses'] ) ) { |
| | 461 | + $puppetinfo['classes'][] = $class; |
| | 462 | + } |
| | 463 | + } |
| | 464 | + foreach ( $wgOpenStackManagerPuppetOptions['availablevariables'] as $variable ) { |
| | 465 | + if ( isset ( $formData["$variable"] ) ) { |
| | 466 | + $puppetinfo['variables']["$variable"] = $formData["$variable"]; |
| | 467 | + } |
| | 468 | + } |
| | 469 | + } |
| | 470 | + $success = $host->modifyPuppetConfiguration( $puppetinfo ); |
| | 471 | + if ( $success ) { |
| | 472 | + $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-modifiedinstance' ) ); |
| | 473 | + } else { |
| | 474 | + $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-modifyinstancefailed' ) ); |
| | 475 | + } |
| | 476 | + } else { |
| | 477 | + $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-nonexistanthost' ) ); |
| | 478 | + } |
| | 479 | + $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backinstancelist' ), array(), array(), array() ); |
| | 480 | + |
| | 481 | + $wgOut->addHTML( $out ); |
| | 482 | + return true; |
| | 483 | + } |
| | 484 | + |
| | 485 | + function validateInstanceName( $instancename, $alldata ) { |
| | 486 | + if ( ! preg_match( "/^[a-z][a-z0-9\-]*$/", $instancename ) ) { |
| | 487 | + return Xml::element( 'span', array( 'class' => 'error' ), wfMsg( 'openstackmanager-badinstancename' ) ); |
| | 488 | + } else { |
| | 489 | + return true; |
| | 490 | + } |
| | 491 | + } |
| | 492 | + |
| | 493 | +} |
| | 494 | + |
| | 495 | +class SpecialNovaInstanceForm extends HTMLForm { |
| | 496 | +} |
| Property changes on: trunk/extensions/OpenStackManager/special/SpecialNovaInstance.php |
| ___________________________________________________________________ |
| Added: svn:eol-style |
| 1 | 497 | + native |
| Index: trunk/extensions/OpenStackManager/special/SpecialNovaAddress.php |
| — | — | @@ -0,0 +1,333 @@ |
| | 2 | +<?php |
| | 3 | +class SpecialNovaAddress extends SpecialNova { |
| | 4 | + |
| | 5 | + var $adminNova; |
| | 6 | + var $userNova; |
| | 7 | + var $userLDAP; |
| | 8 | + |
| | 9 | + function __construct() { |
| | 10 | + parent::__construct( 'NovaAddress' ); |
| | 11 | + } |
| | 12 | + |
| | 13 | + function execute( $par ) { |
| | 14 | + global $wgRequest, $wgUser; |
| | 15 | + global $wgOpenStackManagerNovaAdminKeys; |
| | 16 | + |
| | 17 | + if ( ! $wgUser->isLoggedIn() ) { |
| | 18 | + $this->notLoggedIn(); |
| | 19 | + return false; |
| | 20 | + } |
| | 21 | + $this->userLDAP = new OpenStackNovaUser(); |
| | 22 | + if ( ! $this->userLDAP->exists() ) { |
| | 23 | + $this->noCredentials(); |
| | 24 | + return true; |
| | 25 | + } |
| | 26 | + $adminCredentials = $wgOpenStackManagerNovaAdminKeys; |
| | 27 | + $this->adminNova = new OpenStackNovaController( $adminCredentials ); |
| | 28 | + |
| | 29 | + $action = $wgRequest->getVal( 'action' ); |
| | 30 | + if ( $action == "allocate" ) { |
| | 31 | + $this->allocateAddress(); |
| | 32 | + } else if ( $action == "release" ) { |
| | 33 | + $this->releaseAddress(); |
| | 34 | + } else if ( $action == "associate" ) { |
| | 35 | + $this->associateAddress(); |
| | 36 | + } else if ( $action == "disassociate" ) { |
| | 37 | + $this->disassociateAddress(); |
| | 38 | + } else { |
| | 39 | + $this->listAddresses(); |
| | 40 | + } |
| | 41 | + } |
| | 42 | + |
| | 43 | + function allocateAddress() { |
| | 44 | + global $wgRequest, $wgOut; |
| | 45 | + |
| | 46 | + $this->setHeaders(); |
| | 47 | + $wgOut->setPagetitle( wfMsg( 'openstackmanager-allocateaddress' ) ); |
| | 48 | + |
| | 49 | + $project = $wgRequest->getText( 'project' ); |
| | 50 | + $userCredentials = $this->userLDAP->getCredentials( $project ); |
| | 51 | + $this->userNova = new OpenStackNovaController( $userCredentials ); |
| | 52 | + if ( ! $wgRequest->wasPosted() ) { |
| | 53 | + $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-allocateaddress-confirm', array(), $project ) ); |
| | 54 | + $wgOut->addHTML( $out ); |
| | 55 | + } |
| | 56 | + $addressInfo = Array(); |
| | 57 | + $addressInfo['project'] = array( |
| | 58 | + 'type' => 'hidden', |
| | 59 | + 'default' => $project, |
| | 60 | + ); |
| | 61 | + $addressInfo['action'] = array( |
| | 62 | + 'type' => 'hidden', |
| | 63 | + 'default' => 'allocate', |
| | 64 | + ); |
| | 65 | + |
| | 66 | + $addressForm = new SpecialNovaAddressForm( $addressInfo, 'openstackmanager-novaaddress' ); |
| | 67 | + $addressForm->setTitle( SpecialPage::getTitleFor( 'NovaAddress' ) ); |
| | 68 | + $addressForm->setSubmitID( 'novaaddress-form-allocateaddresssubmit' ); |
| | 69 | + $addressForm->setSubmitCallback( array( $this, 'tryAllocateSubmit' ) ); |
| | 70 | + $addressForm->show(); |
| | 71 | + |
| | 72 | + return true; |
| | 73 | + } |
| | 74 | + |
| | 75 | + function releaseAddress() { |
| | 76 | + global $wgOut, $wgRequest; |
| | 77 | + |
| | 78 | + $this->setHeaders(); |
| | 79 | + $wgOut->setPagetitle( wfMsg( 'openstackmanager-releaseaddress' ) ); |
| | 80 | + |
| | 81 | + $project = $wgRequest->getText( 'project' ); |
| | 82 | + $userCredentials = $this->userLDAP->getCredentials( $project ); |
| | 83 | + $this->userNova = new OpenStackNovaController( $userCredentials ); |
| | 84 | + $ip = $wgRequest->getText( 'ip' ); |
| | 85 | + if ( ! $wgRequest->wasPosted() ) { |
| | 86 | + $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-releaseaddress-confirm', array(), $ip ) ); |
| | 87 | + $wgOut->addHTML( $out ); |
| | 88 | + } |
| | 89 | + $addressInfo = Array(); |
| | 90 | + $addressInfo['project'] = array( |
| | 91 | + 'type' => 'hidden', |
| | 92 | + 'default' => $project, |
| | 93 | + ); |
| | 94 | + $addressInfo['ip'] = array( |
| | 95 | + 'type' => 'hidden', |
| | 96 | + 'default' => $ip, |
| | 97 | + ); |
| | 98 | + $addressInfo['action'] = array( |
| | 99 | + 'type' => 'hidden', |
| | 100 | + 'default' => 'release', |
| | 101 | + ); |
| | 102 | + $addressForm = new SpecialNovaAddressForm( $addressInfo, 'openstackmanager-novaaddress' ); |
| | 103 | + $addressForm->setTitle( SpecialPage::getTitleFor( 'NovaAddress' ) ); |
| | 104 | + $addressForm->setSubmitID( 'novaaddress-form-releaseaddresssubmit' ); |
| | 105 | + $addressForm->setSubmitCallback( array( $this, 'tryReleaseSubmit' ) ); |
| | 106 | + $addressForm->setSubmitText( 'confirm' ); |
| | 107 | + $addressForm->show(); |
| | 108 | + |
| | 109 | + return true; |
| | 110 | + } |
| | 111 | + |
| | 112 | + function associateAddress() { |
| | 113 | + global $wgOut, $wgRequest; |
| | 114 | + |
| | 115 | + $this->setHeaders(); |
| | 116 | + $wgOut->setPagetitle( wfMsg( 'openstackmanager-associateaddress' ) ); |
| | 117 | + |
| | 118 | + $ip = $wgRequest->getText( 'ip' ); |
| | 119 | + $project = $wgRequest->getText( 'project' ); |
| | 120 | + $userCredentials = $this->userLDAP->getCredentials( $project ); |
| | 121 | + $this->userNova = new OpenStackNovaController( $userCredentials ); |
| | 122 | + $instances = $this->userNova->getInstances(); |
| | 123 | + $instance_keys = array(); |
| | 124 | + foreach ( $instances as $instance ) { |
| | 125 | + if ( $instance->getOwner() == $project ) { |
| | 126 | + $instancename = $instance->getInstanceName(); |
| | 127 | + $instanceid = $instance->getInstanceId(); |
| | 128 | + $instance_keys["$instancename"] = $instanceid; |
| | 129 | + } |
| | 130 | + } |
| | 131 | + $addressInfo = array(); |
| | 132 | + $addressInfo['project'] = array( |
| | 133 | + 'type' => 'hidden', |
| | 134 | + 'default' => $project, |
| | 135 | + ); |
| | 136 | + $addressInfo['ip'] = array( |
| | 137 | + 'type' => 'hidden', |
| | 138 | + 'default' => $ip, |
| | 139 | + ); |
| | 140 | + $addressInfo['instanceid'] = array( |
| | 141 | + 'type' => 'select', |
| | 142 | + 'label-message' => 'openstackmanager-instancename', |
| | 143 | + 'options' => $instance_keys, |
| | 144 | + ); |
| | 145 | + $addressInfo['action'] = array( |
| | 146 | + 'type' => 'hidden', |
| | 147 | + 'default' => 'associate', |
| | 148 | + ); |
| | 149 | + $addressForm = new SpecialNovaAddressForm( $addressInfo, 'openstackmanager-novaaddress' ); |
| | 150 | + $addressForm->setTitle( SpecialPage::getTitleFor( 'NovaAddress' ) ); |
| | 151 | + $addressForm->setSubmitID( 'novaaddress-form-releaseaddresssubmit' ); |
| | 152 | + $addressForm->setSubmitCallback( array( $this, 'tryAssociateSubmit' ) ); |
| | 153 | + $addressForm->show(); |
| | 154 | + |
| | 155 | + } |
| | 156 | + |
| | 157 | + function disassociateAddress() { |
| | 158 | + global $wgOut, $wgRequest; |
| | 159 | + |
| | 160 | + $this->setHeaders(); |
| | 161 | + $wgOut->setPagetitle( wfMsg( 'openstackmanager-disassociateaddress' ) ); |
| | 162 | + |
| | 163 | + $project = $wgRequest->getText( 'project' ); |
| | 164 | + $userCredentials = $this->userLDAP->getCredentials( $project ); |
| | 165 | + $this->userNova = new OpenStackNovaController( $userCredentials ); |
| | 166 | + $ip = $wgRequest->getText( 'ip' ); |
| | 167 | + if ( ! $wgRequest->wasPosted() ) { |
| | 168 | + $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-disassociateaddress-confirm', array(), $ip ) ); |
| | 169 | + $wgOut->addHTML( $out ); |
| | 170 | + } |
| | 171 | + $addressInfo = Array(); |
| | 172 | + $addressInfo['project'] = array( |
| | 173 | + 'type' => 'hidden', |
| | 174 | + 'default' => $project, |
| | 175 | + ); |
| | 176 | + $addressInfo['ip'] = array( |
| | 177 | + 'type' => 'hidden', |
| | 178 | + 'default' => $ip, |
| | 179 | + ); |
| | 180 | + $addressInfo['action'] = array( |
| | 181 | + 'type' => 'hidden', |
| | 182 | + 'default' => 'disassociate', |
| | 183 | + ); |
| | 184 | + $addressForm = new SpecialNovaAddressForm( $addressInfo, 'openstackmanager-novaaddress' ); |
| | 185 | + $addressForm->setTitle( SpecialPage::getTitleFor( 'NovaAddress' ) ); |
| | 186 | + $addressForm->setSubmitID( 'novaaddress-form-disassociateaddresssubmit' ); |
| | 187 | + $addressForm->setSubmitCallback( array( $this, 'tryDisassociateSubmit' ) ); |
| | 188 | + $addressForm->setSubmitText( 'confirm' ); |
| | 189 | + $addressForm->show(); |
| | 190 | + |
| | 191 | + } |
| | 192 | + |
| | 193 | + function listAddresses() { |
| | 194 | + global $wgOut, $wgUser; |
| | 195 | + |
| | 196 | + $this->setHeaders(); |
| | 197 | + $wgOut->setPagetitle( wfMsg( 'openstackmanager-addresslist' ) ); |
| | 198 | + |
| | 199 | + $userProjects = $this->userLDAP->getProjects(); |
| | 200 | + $out = ''; |
| | 201 | + $sk = $wgUser->getSkin(); |
| | 202 | + $header = Html::element( 'th', array(), wfMsg( 'openstackmanager-address' ) ); |
| | 203 | + $header .= Html::element( 'th', array(), wfMsg( 'openstackmanager-instanceid' ) ); |
| | 204 | + $header .= Html::element( 'th', array(), wfMsg( 'openstackmanager-instancename' ) ); |
| | 205 | + $header .= Html::element( 'th', array(), wfMsg( 'openstackmanager-actions' ) ); |
| | 206 | + $addresses = $this->adminNova->getAddresses(); |
| | 207 | + $projectArr = array(); |
| | 208 | + foreach ( $addresses as $address ) { |
| | 209 | + $ip = $address->getPublicIP(); |
| | 210 | + $instanceid = $address->getInstanceId(); |
| | 211 | + $project = $address->getProject(); |
| | 212 | + $addressOut = Html::element( 'td', array(), $ip ); |
| | 213 | + if ( $instanceid ) { |
| | 214 | + $addressOut .= Html::element( 'td', array(), $instanceid ); |
| | 215 | + $instance = $this->adminNova->getInstance( $instanceid ); |
| | 216 | + $instancename = $instance->getInstanceName(); |
| | 217 | + $addressOut .= Html::element( 'td', array(), $instancename ); |
| | 218 | + } else { |
| | 219 | + $addressOut .= Html::element( 'td', array(), '' ); |
| | 220 | + $addressOut .= Html::element( 'td', array(), '' ); |
| | 221 | + } |
| | 222 | + if ( $instanceid ) { |
| | 223 | + $msg = wfMsg( 'openstackmanager-reassociateaddress' ); |
| | 224 | + } else { |
| | 225 | + $msg = wfMsg( 'openstackmanager-releaseaddress' ); |
| | 226 | + $link = $sk->link( $this->getTitle(), $msg, array(), |
| | 227 | + array( 'action' => 'release', 'ip' => $ip, 'project' => $project ), array() ); |
| | 228 | + $actions = Html::rawElement( 'li', array(), $link ); |
| | 229 | + $msg = wfMsg( 'openstackmanager-associateaddress' ); |
| | 230 | + } |
| | 231 | + $link = $sk->link( $this->getTitle(), $msg, array(), |
| | 232 | + array( 'action' => 'associate', 'ip' => $ip, 'project' => $project ), array() ); |
| | 233 | + $actions .= Html::rawElement( 'li', array(), $link ); |
| | 234 | + if ( $instanceid ) { |
| | 235 | + $msg = wfMsg( 'openstackmanager-disassociateaddress' ); |
| | 236 | + $link = $sk->link( $this->getTitle(), $msg, array(), |
| | 237 | + array( 'action' => 'disassociate', 'ip' => $ip, 'project' => $project ), array() ); |
| | 238 | + $actions .= Html::rawElement( 'li', array(), $link ); |
| | 239 | + } |
| | 240 | + $actions = Html::rawElement( 'ul', array(), $actions ); |
| | 241 | + $addressOut .= Html::rawElement( 'td', array(), $actions ); |
| | 242 | + $projectArr["$project"] = Html::rawElement( 'tr', array(), $addressOut ); |
| | 243 | + } |
| | 244 | + foreach ( $userProjects as $project ) { |
| | 245 | + $out .= Html::element( 'h2', array(), $project ); |
| | 246 | + $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-allocateaddress' ), array(), array( 'action' => 'allocate', 'project' => $project ), array() ); |
| | 247 | + if ( isset( $projectArr["$project"] ) ) { |
| | 248 | + $projectOut = $header; |
| | 249 | + $projectOut .= $projectArr["$project"]; |
| | 250 | + $out .= Html::rawElement( 'table', |
| | 251 | + array( 'id' => 'novainstancelist', 'class' => 'wikitable' ), $projectOut ); |
| | 252 | + } |
| | 253 | + } |
| | 254 | + $wgOut->addHTML( $out ); |
| | 255 | + } |
| | 256 | + |
| | 257 | + function tryAllocateSubmit( $formData, $entryPoint = 'internal' ) { |
| | 258 | + global $wgOut, $wgUser; |
| | 259 | + |
| | 260 | + $address = $this->userNova->allocateAddress(); |
| | 261 | + if ( ! $address ) { |
| | 262 | + $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-allocateaddressfailed' ) ); |
| | 263 | + $wgOut->addHTML( $out ); |
| | 264 | + return false; |
| | 265 | + } |
| | 266 | + $ip = $address->getPublicIP(); |
| | 267 | + $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-allocatedaddress' , array(), $ip ) ); |
| | 268 | + $out .= '<br />'; |
| | 269 | + $sk = $wgUser->getSkin(); |
| | 270 | + $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backaddresslist' ), array(), array(), array() ); |
| | 271 | + $wgOut->addHTML( $out ); |
| | 272 | + |
| | 273 | + return true; |
| | 274 | + } |
| | 275 | + |
| | 276 | + function tryReleaseSubmit( $formData, $entryPoint = 'internal' ) { |
| | 277 | + global $wgOut, $wgUser; |
| | 278 | + |
| | 279 | + $ip = $formData['ip']; |
| | 280 | + $success = $this->userNova->releaseAddress( $ip ); |
| | 281 | + if ( $success ) { |
| | 282 | + $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-releasedaddress', array(), $ip ) ); |
| | 283 | + } else { |
| | 284 | + $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-releaseaddressfailed', array(), $ip ) ); |
| | 285 | + } |
| | 286 | + $out .= '<br />'; |
| | 287 | + $sk = $wgUser->getSkin(); |
| | 288 | + $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backaddresslist' ), array(), array(), array() ); |
| | 289 | + $wgOut->addHTML( $out ); |
| | 290 | + |
| | 291 | + return true; |
| | 292 | + } |
| | 293 | + |
| | 294 | + function tryAssociateSubmit( $formData, $entryPoint = 'internal' ) { |
| | 295 | + global $wgOut, $wgUser; |
| | 296 | + |
| | 297 | + $instanceid = $formData['instanceid']; |
| | 298 | + $ip = $formData['ip']; |
| | 299 | + $address = $this->userNova->associateAddress( $instanceid, $ip ); |
| | 300 | + if ( $address ) { |
| | 301 | + $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-associatedaddress', array(), $ip, $instanceid ) ); |
| | 302 | + } else { |
| | 303 | + $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-associateaddressfailed', array(), $ip, $instanceid ) ); |
| | 304 | + } |
| | 305 | + $out .= '<br />'; |
| | 306 | + $sk = $wgUser->getSkin(); |
| | 307 | + $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backaddresslist' ), array(), array(), array() ); |
| | 308 | + $wgOut->addHTML( $out ); |
| | 309 | + |
| | 310 | + return true; |
| | 311 | + } |
| | 312 | + |
| | 313 | + function tryDisassociateSubmit( $formData, $entryPoint = 'internal' ) { |
| | 314 | + global $wgOut, $wgUser; |
| | 315 | + |
| | 316 | + $ip = $formData['ip']; |
| | 317 | + $address = $this->userNova->disassociateAddress( $ip ); |
| | 318 | + if ( $address ) { |
| | 319 | + $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-disassociatedaddress', array(), $ip ) ); |
| | 320 | + } else { |
| | 321 | + $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-disassociateaddressfailed', array(), $ip ) ); |
| | 322 | + } |
| | 323 | + $out .= '<br />'; |
| | 324 | + $sk = $wgUser->getSkin(); |
| | 325 | + $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backaddresslist' ), array(), array(), array() ); |
| | 326 | + $wgOut->addHTML( $out ); |
| | 327 | + |
| | 328 | + return true; |
| | 329 | + } |
| | 330 | + |
| | 331 | +} |
| | 332 | + |
| | 333 | +class SpecialNovaAddressForm extends HTMLForm { |
| | 334 | +} |
| Property changes on: trunk/extensions/OpenStackManager/special/SpecialNovaAddress.php |
| ___________________________________________________________________ |
| Added: svn:eol-style |
| 1 | 335 | + native |
| Index: trunk/extensions/OpenStackManager/special/SpecialNovaProject.php |
| — | — | @@ -0,0 +1,303 @@ |
| | 2 | +<?php |
| | 3 | +class SpecialNovaProject extends SpecialNova { |
| | 4 | + |
| | 5 | + var $userNova, $adminNova; |
| | 6 | + |
| | 7 | + function __construct() { |
| | 8 | + parent::__construct( 'NovaProject' ); |
| | 9 | + |
| | 10 | + global $wgOpenStackManagerNovaAdminKeys; |
| | 11 | + |
| | 12 | + $this->userLDAP = new OpenStackNovaUser(); |
| | 13 | + $adminCredentials = $wgOpenStackManagerNovaAdminKeys; |
| | 14 | + $this->adminNova = new OpenStackNovaController( $adminCredentials ); |
| | 15 | + } |
| | 16 | + |
| | 17 | + public function isRestricted() { |
| | 18 | + return true; |
| | 19 | + } |
| | 20 | + |
| | 21 | +# public function userCanExecute( $user ) { |
| | 22 | +# global $wgRequest; |
| | 23 | +# |
| | 24 | +# #$project = $wgRequest->getVal('project'); |
| | 25 | +# #if ( $project && ! $this->userLDAP->inProject( $project ) ) { |
| | 26 | +# # return false; |
| | 27 | +# #} |
| | 28 | +# return true; |
| | 29 | +# } |
| | 30 | + |
| | 31 | + function execute( $par ) { |
| | 32 | + global $wgRequest, $wgUser; |
| | 33 | + |
| | 34 | + # if ( ! $wgUser->isAllowed( 'manageproject' ) ) { |
| | 35 | + # return false; |
| | 36 | + # } |
| | 37 | + if ( ! $wgUser->isLoggedIn() ) { |
| | 38 | + $this->notLoggedIn(); |
| | 39 | + return false; |
| | 40 | + } |
| | 41 | + |
| | 42 | + $action = $wgRequest->getVal( 'action' ); |
| | 43 | + if ( $action == "create" ) { |
| | 44 | + $this->createProject(); |
| | 45 | + } else if ( $action == "delete" ) { |
| | 46 | + $this->deleteProject(); |
| | 47 | + } else if ( $action == "addmember" ) { |
| | 48 | + $this->addMember(); |
| | 49 | + } else if ( $action == "deletemember" ) { |
| | 50 | + $this->deleteMember(); |
| | 51 | + } else { |
| | 52 | + $this->listProjects(); |
| | 53 | + } |
| | 54 | + } |
| | 55 | + |
| | 56 | + function createProject() { |
| | 57 | + global $wgRequest, $wgOut; |
| | 58 | + |
| | 59 | + $this->setHeaders(); |
| | 60 | + $wgOut->setPagetitle( wfMsg( 'openstackmanager-createproject' ) ); |
| | 61 | + |
| | 62 | + $projectInfo = Array(); |
| | 63 | + $projectInfo['projectname'] = array( |
| | 64 | + 'type' => 'text', |
| | 65 | + 'label-message' => 'openstackmanager-projectname', |
| | 66 | + 'default' => '', |
| | 67 | + 'section' => 'project/info', |
| | 68 | + ); |
| | 69 | + |
| | 70 | + $projectInfo['action'] = array( |
| | 71 | + 'type' => 'hidden', |
| | 72 | + 'default' => 'create', |
| | 73 | + ); |
| | 74 | + |
| | 75 | + $projectForm = new SpecialNovaProjectForm( $projectInfo, 'openstackmanager-novaproject' ); |
| | 76 | + $projectForm->setTitle( SpecialPage::getTitleFor( 'NovaProject' ) ); |
| | 77 | + $projectForm->setSubmitID( 'novaproject-form-createprojectsubmit' ); |
| | 78 | + $projectForm->setSubmitCallback( array( $this, 'tryCreateSubmit' ) ); |
| | 79 | + $projectForm->show(); |
| | 80 | + |
| | 81 | + return true; |
| | 82 | + } |
| | 83 | + |
| | 84 | + function addMember() { |
| | 85 | + global $wgRequest, $wgOut; |
| | 86 | + |
| | 87 | + $this->setHeaders(); |
| | 88 | + $wgOut->setPagetitle( wfMsg( 'openstackmanager-addmember' ) ); |
| | 89 | + |
| | 90 | + $project = $wgRequest->getText( 'projectname' ); |
| | 91 | + $projectInfo = Array(); |
| | 92 | + $projectInfo['member'] = array( |
| | 93 | + 'type' => 'text', |
| | 94 | + 'label-message' => 'openstackmanager-member', |
| | 95 | + 'default' => '', |
| | 96 | + 'section' => 'project/info', |
| | 97 | + ); |
| | 98 | + $projectInfo['action'] = array( |
| | 99 | + 'type' => 'hidden', |
| | 100 | + 'default' => 'addmember', |
| | 101 | + ); |
| | 102 | + $projectInfo['projectname'] = array( |
| | 103 | + 'type' => 'hidden', |
| | 104 | + 'default' => $project, |
| | 105 | + ); |
| | 106 | + |
| | 107 | + $projectForm = new SpecialNovaProjectForm( $projectInfo, 'openstackmanager-novaproject' ); |
| | 108 | + $projectForm->setTitle( SpecialPage::getTitleFor( 'NovaProject' ) ); |
| | 109 | + $projectForm->setSubmitID( 'novaproject-form-addmembersubmit' ); |
| | 110 | + $projectForm->setSubmitCallback( array( $this, 'tryAddMemberSubmit' ) ); |
| | 111 | + $projectForm->show(); |
| | 112 | + |
| | 113 | + return true; |
| | 114 | + } |
| | 115 | + |
| | 116 | + function deleteMember() { |
| | 117 | + global $wgRequest, $wgOut; |
| | 118 | + |
| | 119 | + $this->setHeaders(); |
| | 120 | + $wgOut->setPagetitle( wfMsg( 'openstackmanager-removemember' ) ); |
| | 121 | + |
| | 122 | + $member = $wgRequest->getText( 'member' ); |
| | 123 | + $project = $wgRequest->getText( 'projectname' ); |
| | 124 | + if ( ! $wgRequest->wasPosted() ) { |
| | 125 | + $out .= Html::element( 'p', array(), wfMsgExt( 'openstackmanager-removememberconfirm', array(), $member, $project ) ); |
| | 126 | + $wgOut->addHTML( $out ); |
| | 127 | + } |
| | 128 | + $projectInfo = Array(); |
| | 129 | + $projectInfo['member'] = array( |
| | 130 | + 'type' => 'hidden', |
| | 131 | + 'default' => $member, |
| | 132 | + ); |
| | 133 | + $projectInfo['action'] = array( |
| | 134 | + 'type' => 'hidden', |
| | 135 | + 'default' => 'deletemember', |
| | 136 | + ); |
| | 137 | + $projectInfo['projectname'] = array( |
| | 138 | + 'type' => 'hidden', |
| | 139 | + 'default' => $project, |
| | 140 | + ); |
| | 141 | + |
| | 142 | + $projectForm = new SpecialNovaProjectForm( $projectInfo, 'openstackmanager-novaproject' ); |
| | 143 | + $projectForm->setTitle( SpecialPage::getTitleFor( 'NovaProject' ) ); |
| | 144 | + $projectForm->setSubmitID( 'novaproject-form-deletemembersubmit' ); |
| | 145 | + $projectForm->setSubmitCallback( array( $this, 'tryDeleteMemberSubmit' ) ); |
| | 146 | + $projectForm->show(); |
| | 147 | + |
| | 148 | + return true; |
| | 149 | + } |
| | 150 | + |
| | 151 | + function deleteProject() { |
| | 152 | + global $wgOut, $wgRequest; |
| | 153 | + |
| | 154 | + $this->setHeaders(); |
| | 155 | + $wgOut->setPagetitle( wfMsg( 'openstackmanager-deleteproject' ) ); |
| | 156 | + |
| | 157 | + $project = $wgRequest->getText( 'projectname' ); |
| | 158 | + if ( ! $wgRequest->wasPosted() ) { |
| | 159 | + $out .= Html::element( 'p', array(), wfMsgExt( 'openstackmanager-removeprojectconfirm', array(), $project ) ); |
| | 160 | + $wgOut->addHTML( $out ); |
| | 161 | + } |
| | 162 | + $projectInfo = Array(); |
| | 163 | + $projectInfo['projectname'] = array( |
| | 164 | + 'type' => 'hidden', |
| | 165 | + 'default' => $project, |
| | 166 | + ); |
| | 167 | + $projectInfo['action'] = array( |
| | 168 | + 'type' => 'hidden', |
| | 169 | + 'default' => 'delete', |
| | 170 | + ); |
| | 171 | + $projectForm = new SpecialNovaProjectForm( $projectInfo, 'openstackmanager-novaproject' ); |
| | 172 | + $projectForm->setTitle( SpecialPage::getTitleFor( 'NovaProject' ) ); |
| | 173 | + $projectForm->setSubmitID( 'novaproject-form-deleteprojectsubmit' ); |
| | 174 | + $projectForm->setSubmitCallback( array( $this, 'tryDeleteSubmit' ) ); |
| | 175 | + $projectForm->setSubmitText( 'confirm' ); |
| | 176 | + $projectForm->show(); |
| | 177 | + |
| | 178 | + return true; |
| | 179 | + } |
| | 180 | + |
| | 181 | + function listProjects() { |
| | 182 | + global $wgOut, $wgUser; |
| | 183 | + |
| | 184 | + $this->setHeaders(); |
| | 185 | + $wgOut->setPagetitle( wfMsg( 'openstackmanager-projectlist' ) ); |
| | 186 | + |
| | 187 | + $out = ''; |
| | 188 | + $sk = $wgUser->getSkin(); |
| | 189 | + $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-createproject' ), array(), array( 'action' => 'create' ), array() ); |
| | 190 | + $projectsOut = Html::element( 'th', array(), wfMsg( 'openstackmanager-projectname' ) ); |
| | 191 | + $projectsOut .= Html::element( 'th', array(), wfMsg( 'openstackmanager-members' ) ); |
| | 192 | + $projectsOut .= Html::element( 'th', array(), wfMsg( 'openstackmanager-actions' ) ); |
| | 193 | + $projects = OpenStackNovaProject::getAllProjects(); |
| | 194 | + if ( ! $projects ) { |
| | 195 | + $projectsOut = ''; |
| | 196 | + } |
| | 197 | + foreach ( $projects as $project ) { |
| | 198 | + $projectName = $project->getProjectName(); |
| | 199 | + $projectOut = Html::element( 'td', array(), $projectName ); |
| | 200 | + $projectMembers = $project->getMembers(); |
| | 201 | + $memberOut = ''; |
| | 202 | + foreach ( $projectMembers as $projectMember ) { |
| | 203 | + $link = $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-removemember' ), array(), |
| | 204 | + array( 'action' => 'deletemember', 'projectname' => $projectName, 'member' => $projectMember ), array() ); |
| | 205 | + $projectMemberOut = htmlentities( $projectMember ) . ' (' . $link . ')'; |
| | 206 | + $memberOut .= Html::rawElement( 'li', array(), $projectMemberOut ); |
| | 207 | + } |
| | 208 | + if ( $memberOut ) { |
| | 209 | + $memberOut .= '<br />'; |
| | 210 | + $memberOut = Html::rawElement( 'ul', array(), $memberOut ); |
| | 211 | + } |
| | 212 | + $memberOut .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-addmember' ), array(), |
| | 213 | + array( 'action' => 'addmember', 'projectname' => $projectName ), array() ); |
| | 214 | + $projectOut .= Html::rawElement( 'td', array(), $memberOut ); |
| | 215 | + $link = $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-deleteproject' ), array(), |
| | 216 | + array( 'action' => 'delete', 'projectname' => $projectName ), array() ); |
| | 217 | + $projectOut .= Html::rawElement( 'td', array(), $link ); |
| | 218 | + $projectsOut .= Html::rawElement( 'tr', array(), $projectOut ); |
| | 219 | + } |
| | 220 | + if ( $projectsOut ) { |
| | 221 | + $out .= Html::rawElement( 'table', array( 'class' => 'wikitable' ), $projectsOut ); |
| | 222 | + } |
| | 223 | + |
| | 224 | + $wgOut->addHTML( $out ); |
| | 225 | + } |
| | 226 | + |
| | 227 | + function tryCreateSubmit( $formData, $entryPoint = 'internal' ) { |
| | 228 | + global $wgOut, $wgUser; |
| | 229 | + |
| | 230 | + $success = OpenStackNovaProject::createProject( $formData['projectname'] ); |
| | 231 | + if ( ! $success ) { |
| | 232 | + $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-createprojectfailed' ) ); |
| | 233 | + $wgOut->addHTML( $out ); |
| | 234 | + return false; |
| | 235 | + } |
| | 236 | + $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-createdproject' ) ); |
| | 237 | + $out .= '<br />'; |
| | 238 | + $sk = $wgUser->getSkin(); |
| | 239 | + $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backprojectlist' ), array(), array(), array() ); |
| | 240 | + $wgOut->addHTML( $out ); |
| | 241 | + |
| | 242 | + return true; |
| | 243 | + } |
| | 244 | + |
| | 245 | + function tryDeleteSubmit( $formData, $entryPoint = 'internal' ) { |
| | 246 | + global $wgOut, $wgUser; |
| | 247 | + |
| | 248 | + $success = OpenStackNovaProject::deleteProject( $formData['projectname'] ); |
| | 249 | + if ( $success ) { |
| | 250 | + $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-deletedproject' ) ); |
| | 251 | + } else { |
| | 252 | + $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-deleteprojectfailed' ) ); |
| | 253 | + } |
| | 254 | + $out .= '<br />'; |
| | 255 | + $sk = $wgUser->getSkin(); |
| | 256 | + $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backprojectlist' ), array(), array(), array() ); |
| | 257 | + $wgOut->addHTML( $out ); |
| | 258 | + |
| | 259 | + return true; |
| | 260 | + } |
| | 261 | + |
| | 262 | + function tryAddMemberSubmit( $formData, $entryPoint = 'internal' ) { |
| | 263 | + global $wgOut, $wgUser; |
| | 264 | + |
| | 265 | + $project = new OpenStackNovaProject( $formData['projectname'] ); |
| | 266 | + $success = $project->addMember( $formData['member'] ); |
| | 267 | + if ( $success ) { |
| | 268 | + $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-addedto', array(), $formData['member'], |
| | 269 | + $formData['projectname'] ) ); |
| | 270 | + } else { |
| | 271 | + $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-failedtoadd', array(), $formData['member'], |
| | 272 | + $formData['projectname'] ) ); |
| | 273 | + } |
| | 274 | + $out .= '<br />'; |
| | 275 | + $sk = $wgUser->getSkin(); |
| | 276 | + $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backprojectlist' ), array(), array(), array() ); |
| | 277 | + $wgOut->addHTML( $out ); |
| | 278 | + |
| | 279 | + return true; |
| | 280 | + } |
| | 281 | + |
| | 282 | + function tryDeleteMemberSubmit( $formData, $entryPoint = 'internal' ) { |
| | 283 | + global $wgOut, $wgUser; |
| | 284 | + |
| | 285 | + $project = new OpenStackNovaProject( $formData['projectname'] ); |
| | 286 | + $success = $project->deleteMember( $formData['member'] ); |
| | 287 | + if ( $success ) { |
| | 288 | + $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-removedfrom', array(), $formData['member'], |
| | 289 | + $formData['projectname'] ) ); |
| | 290 | + } else { |
| | 291 | + $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-failedtoremove', array(), $formData['member'], |
| | 292 | + $formData['projectname'] ) ); |
| | 293 | + } |
| | 294 | + $out .= '<br />'; |
| | 295 | + $sk = $wgUser->getSkin(); |
| | 296 | + $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backprojectlist' ), array(), array(), array() ); |
| | 297 | + $wgOut->addHTML( $out ); |
| | 298 | + |
| | 299 | + return true; |
| | 300 | + } |
| | 301 | +} |
| | 302 | + |
| | 303 | +class SpecialNovaProjectForm extends HTMLForm { |
| | 304 | +} |
| Property changes on: trunk/extensions/OpenStackManager/special/SpecialNovaProject.php |
| ___________________________________________________________________ |
| Added: svn:eol-style |
| 1 | 305 | + native |
| Index: trunk/extensions/OpenStackManager/special/SpecialNovaDomain.php |
| — | — | @@ -0,0 +1,182 @@ |
| | 2 | +<?php |
| | 3 | +class SpecialNovaDomain extends SpecialNova { |
| | 4 | + |
| | 5 | + var $userNova, $adminNova; |
| | 6 | + |
| | 7 | + function __construct() { |
| | 8 | + parent::__construct( 'NovaDomain' ); |
| | 9 | + |
| | 10 | + global $wgOpenStackManagerNovaAdminKeys; |
| | 11 | + |
| | 12 | + $this->userLDAP = new OpenStackNovaUser(); |
| | 13 | + $this->adminNova = new OpenStackNovaController( $wgOpenStackManagerNovaAdminKeys ); |
| | 14 | + } |
| | 15 | + |
| | 16 | + public function isRestricted() { |
| | 17 | + return true; |
| | 18 | + } |
| | 19 | + |
| | 20 | + function execute( $par ) { |
| | 21 | + global $wgRequest, $wgUser; |
| | 22 | + |
| | 23 | + # if ( ! $wgUser->isAllowed( 'manageproject' ) ) { |
| | 24 | + # return false; |
| | 25 | + # } |
| | 26 | + if ( ! $wgUser->isLoggedIn() ) { |
| | 27 | + $this->notLoggedIn(); |
| | 28 | + return false; |
| | 29 | + } |
| | 30 | + |
| | 31 | + $action = $wgRequest->getVal( 'action' ); |
| | 32 | + if ( $action == "create" ) { |
| | 33 | + $this->createDomain(); |
| | 34 | + } else if ( $action == "delete" ) { |
| | 35 | + $this->deleteDomain(); |
| | 36 | + } else { |
| | 37 | + $this->listDomains(); |
| | 38 | + } |
| | 39 | + } |
| | 40 | + |
| | 41 | + function createDomain() { |
| | 42 | + global $wgRequest, $wgOut; |
| | 43 | + global $wgOpenStackManagerDNSOptions; |
| | 44 | + |
| | 45 | + $this->setHeaders(); |
| | 46 | + $wgOut->setPagetitle( wfMsg( 'openstackmanager-createdomain' ) ); |
| | 47 | + |
| | 48 | + $domainInfo = Array(); |
| | 49 | + $domainInfo['domainname'] = array( |
| | 50 | + 'type' => 'text', |
| | 51 | + 'label-message' => 'openstackmanager-domainname', |
| | 52 | + 'default' => '', |
| | 53 | + 'section' => 'domain/info', |
| | 54 | + ); |
| | 55 | + $domainInfo['fqdn'] = array( |
| | 56 | + 'type' => 'text', |
| | 57 | + 'label-message' => 'openstackmanager-fqdn', |
| | 58 | + 'default' => '', |
| | 59 | + 'section' => 'domain/info', |
| | 60 | + ); |
| | 61 | + $domainInfo['location'] = array( |
| | 62 | + 'type' => 'text', |
| | 63 | + 'label-message' => 'openstackmanager-location', |
| | 64 | + 'default' => '', |
| | 65 | + 'section' => 'domain/info', |
| | 66 | + ); |
| | 67 | + $domainInfo['action'] = array( |
| | 68 | + 'type' => 'hidden', |
| | 69 | + 'default' => 'create', |
| | 70 | + ); |
| | 71 | + |
| | 72 | + $domainForm = new SpecialNovaDomainForm( $domainInfo, 'openstackmanager-novadomain' ); |
| | 73 | + $domainForm->setTitle( SpecialPage::getTitleFor( 'NovaDomain' ) ); |
| | 74 | + $domainForm->setSubmitID( 'novadomain-form-createdomainsubmit' ); |
| | 75 | + $domainForm->setSubmitCallback( array( $this, 'tryCreateSubmit' ) ); |
| | 76 | + $domainForm->show(); |
| | 77 | + |
| | 78 | + return true; |
| | 79 | + } |
| | 80 | + |
| | 81 | + function deleteDomain() { |
| | 82 | + global $wgOut, $wgRequest; |
| | 83 | + |
| | 84 | + $this->setHeaders(); |
| | 85 | + $wgOut->setPagetitle( wfMsg( 'openstackmanager-deletedomain' ) ); |
| | 86 | + |
| | 87 | + $domainname = $wgRequest->getText( 'domainname' ); |
| | 88 | + if ( ! $wgRequest->wasPosted() ) { |
| | 89 | + $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-deletedomain-confirm', array(), $domainname ) ); |
| | 90 | + $wgOut->addHTML( $out ); |
| | 91 | + } |
| | 92 | + $domainInfo = Array(); |
| | 93 | + $domainInfo['domainname'] = array( |
| | 94 | + 'type' => 'hidden', |
| | 95 | + 'default' => $domainname, |
| | 96 | + ); |
| | 97 | + $domainInfo['action'] = array( |
| | 98 | + 'type' => 'hidden', |
| | 99 | + 'default' => 'delete', |
| | 100 | + ); |
| | 101 | + $domainForm = new SpecialNovaDomainForm( $domainInfo, 'openstackmanager-novadomain' ); |
| | 102 | + $domainForm->setTitle( SpecialPage::getTitleFor( 'NovaDomain' ) ); |
| | 103 | + $domainForm->setSubmitID( 'novadomain-form-deletedomainsubmit' ); |
| | 104 | + $domainForm->setSubmitCallback( array( $this, 'tryDeleteSubmit' ) ); |
| | 105 | + $domainForm->setSubmitText( 'confirm' ); |
| | 106 | + $domainForm->show(); |
| | 107 | + |
| | 108 | + return true; |
| | 109 | + } |
| | 110 | + |
| | 111 | + function listDomains() { |
| | 112 | + global $wgOut, $wgUser; |
| | 113 | + |
| | 114 | + $this->setHeaders(); |
| | 115 | + $wgOut->setPagetitle( wfMsg( 'openstackmanager-domainlist' ) ); |
| | 116 | + |
| | 117 | + $out = ''; |
| | 118 | + $sk = $wgUser->getSkin(); |
| | 119 | + $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-createdomain' ), array(), array( 'action' => 'create' ), array() ); |
| | 120 | + $domainsOut = Html::element( 'th', array(), wfMsg( 'openstackmanager-domainname' ) ); |
| | 121 | + $domainsOut .= Html::element( 'th', array(), wfMsg( 'openstackmanager-fqdn' ) ); |
| | 122 | + $domainsOut .= Html::element( 'th', array(), wfMsg( 'openstackmanager-location' ) ); |
| | 123 | + $domainsOut .= Html::element( 'th', array(), wfMsg( 'openstackmanager-actions' ) ); |
| | 124 | + $domains = OpenStackNovaDomain::getAllDomains(); |
| | 125 | + foreach ( $domains as $domain ) { |
| | 126 | + $domainName = $domain->getDomainName(); |
| | 127 | + $fqdn = $domain->getFullyQualifiedDomainName(); |
| | 128 | + $location = $domain->getLocation(); |
| | 129 | + $domainOut = Html::element( 'td', array(), $domainName ); |
| | 130 | + $domainOut .= Html::element( 'td', array(), $fqdn ); |
| | 131 | + $domainOut .= Html::element( 'td', array(), $location ); |
| | 132 | + $msg = wfMsg( 'openstackmanager-delete' ); |
| | 133 | + $link = $sk->link( $this->getTitle(), $msg, array(), |
| | 134 | + array( 'action' => 'delete', 'domainname' => $domainName ), array() ); |
| | 135 | + $domainOut .= Html::rawElement( 'td', array(), $link ); |
| | 136 | + $domainsOut .= Html::rawElement( 'tr', array(), $domainOut ); |
| | 137 | + } |
| | 138 | + if ( $domains ) { |
| | 139 | + $out .= Html::rawElement( 'table', array( 'class' => 'wikitable' ), $domainsOut ); |
| | 140 | + } |
| | 141 | + |
| | 142 | + $wgOut->addHTML( $out ); |
| | 143 | + } |
| | 144 | + |
| | 145 | + function tryCreateSubmit( $formData, $entryPoint = 'internal' ) { |
| | 146 | + global $wgOut, $wgUser; |
| | 147 | + |
| | 148 | + $success = OpenStackNovaDomain::createDomain( $formData['domainname'], $formData['fqdn'], $formData['location'] ); |
| | 149 | + if ( ! $success ) { |
| | 150 | + $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-createdomainfailed' ) ); |
| | 151 | + $wgOut->addHTML( $out ); |
| | 152 | + return false; |
| | 153 | + } |
| | 154 | + $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-createddomain' ) ); |
| | 155 | + $out .= '<br />'; |
| | 156 | + $sk = $wgUser->getSkin(); |
| | 157 | + $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backdomainlist' ), array(), array(), array() ); |
| | 158 | + $wgOut->addHTML( $out ); |
| | 159 | + |
| | 160 | + return true; |
| | 161 | + } |
| | 162 | + |
| | 163 | + function tryDeleteSubmit( $formData, $entryPoint = 'internal' ) { |
| | 164 | + global $wgOut, $wgUser; |
| | 165 | + |
| | 166 | + $success = OpenStackNovaDomain::deleteDomain( $formData['domainname'] ); |
| | 167 | + if ( $success ) { |
| | 168 | + $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-deleteddomain' ) ); |
| | 169 | + } else { |
| | 170 | + $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-failedeletedomain' ) ); |
| | 171 | + } |
| | 172 | + $out .= '<br />'; |
| | 173 | + $sk = $wgUser->getSkin(); |
| | 174 | + $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backdomainlist' ), array(), array(), array() ); |
| | 175 | + $wgOut->addHTML( $out ); |
| | 176 | + |
| | 177 | + return true; |
| | 178 | + } |
| | 179 | + |
| | 180 | +} |
| | 181 | + |
| | 182 | +class SpecialNovaDomainForm extends HTMLForm { |
| | 183 | +} |
| Property changes on: trunk/extensions/OpenStackManager/special/SpecialNovaDomain.php |
| ___________________________________________________________________ |
| Added: svn:eol-style |
| 1 | 184 | + native |
| Index: trunk/extensions/OpenStackManager/special/SpecialNovaKey.php |
| — | — | @@ -0,0 +1,241 @@ |
| | 2 | +<?php |
| | 3 | +class SpecialNovaKey extends SpecialNova { |
| | 4 | + |
| | 5 | + var $userNova, $userLDAP; |
| | 6 | + |
| | 7 | + function __construct() { |
| | 8 | + parent::__construct( 'NovaKey' ); |
| | 9 | + } |
| | 10 | + |
| | 11 | + public function isRestricted() { |
| | 12 | + return true; |
| | 13 | + } |
| | 14 | + |
| | 15 | + function execute( $par ) { |
| | 16 | + global $wgRequest, $wgUser; |
| | 17 | + |
| | 18 | + if ( ! $wgUser->isLoggedIn() ) { |
| | 19 | + $this->notLoggedIn(); |
| | 20 | + return true; |
| | 21 | + } |
| | 22 | + $this->userLDAP = new OpenStackNovaUser(); |
| | 23 | + if ( ! $this->userLDAP->exists() ) { |
| | 24 | + $this->noCredentials(); |
| | 25 | + return true; |
| | 26 | + } |
| | 27 | + |
| | 28 | + $action = $wgRequest->getVal( 'action' ); |
| | 29 | + if ( $action == "import" ) { |
| | 30 | + $this->importKey(); |
| | 31 | + } else if ( $action == "delete" ) { |
| | 32 | + $this->deleteKey(); |
| | 33 | + } else { |
| | 34 | + $this->listKeys(); |
| | 35 | + } |
| | 36 | + } |
| | 37 | + |
| | 38 | + function importKey() { |
| | 39 | + global $wgRequest, $wgOut; |
| | 40 | + global $wgOpenStackManagerNovaKeypairStorage; |
| | 41 | + |
| | 42 | + if ( $wgOpenStackManagerNovaKeypairStorage == 'nova' ) { |
| | 43 | + $project = $wgRequest->getVal( 'project' ); |
| | 44 | + if ( $project && ! $this->userLDAP->inProject( $project ) ) { |
| | 45 | + $this->notInProject(); |
| | 46 | + return true; |
| | 47 | + } |
| | 48 | + $userCredentials = $this->userLDAP->getCredentials( $project ); |
| | 49 | + $this->userNova = new OpenStackNovaController( $userCredentials ); |
| | 50 | + } |
| | 51 | + |
| | 52 | + $this->setHeaders(); |
| | 53 | + $wgOut->setPagetitle( wfMsg( 'openstackmanager-importkey' ) ); |
| | 54 | + |
| | 55 | + $keyInfo = Array(); |
| | 56 | + |
| | 57 | + if ( $wgOpenStackManagerNovaKeypairStorage == 'nova' ) { |
| | 58 | + $keyInfo['keyname'] = array( |
| | 59 | + 'type' => 'text', |
| | 60 | + 'label-message' => 'openstackmanager-keyname', |
| | 61 | + 'default' => '', |
| | 62 | + 'section' => 'key/info', |
| | 63 | + ); |
| | 64 | + } |
| | 65 | + |
| | 66 | + $keyInfo['key'] = array( |
| | 67 | + 'type' => 'textarea', |
| | 68 | + 'section' => 'key/info', |
| | 69 | + 'default' => '', |
| | 70 | + 'label-message' => 'openstackmanager-key', |
| | 71 | + ); |
| | 72 | + |
| | 73 | + $keyInfo['action'] = array( |
| | 74 | + 'type' => 'hidden', |
| | 75 | + 'default' => 'import', |
| | 76 | + ); |
| | 77 | + |
| | 78 | + $keyInfo['project'] = array( |
| | 79 | + 'type' => 'hidden', |
| | 80 | + 'default' => htmlentities( $project ), |
| | 81 | + ); |
| | 82 | + |
| | 83 | + $keyForm = new SpecialNovaKeyForm( $keyInfo, 'openstackmanager-novakey' ); |
| | 84 | + $keyForm->setTitle( SpecialPage::getTitleFor( 'NovaKey' ) ); |
| | 85 | + $keyForm->setSubmitID( 'novakey-form-createkeysubmit' ); |
| | 86 | + $keyForm->setSubmitCallback( array( $this, 'tryImportSubmit' ) ); |
| | 87 | + $keyForm->show(); |
| | 88 | + |
| | 89 | + } |
| | 90 | + |
| | 91 | + function deleteKey() { |
| | 92 | + global $wgOut, $wgRequest; |
| | 93 | + global $wgOpenStackManagerNovaKeypairStorage; |
| | 94 | + |
| | 95 | + $this->setHeaders(); |
| | 96 | + $wgOut->setPagetitle( wfMsg( 'openstackmanager-deletekey' ) ); |
| | 97 | + |
| | 98 | + $keyInfo = Array(); |
| | 99 | + |
| | 100 | + if ( $wgOpenStackManagerNovaKeypairStorage == 'nova' ) { |
| | 101 | + $keyname = $wgRequest->getVal( 'keyname' ); |
| | 102 | + $project = $wgRequest->getVal( 'project' ); |
| | 103 | + if ( $project && ! $this->userLDAP->inProject( $project ) ) { |
| | 104 | + $this->notInProject(); |
| | 105 | + return true; |
| | 106 | + } |
| | 107 | + $keyInfo['keyname'] = array( |
| | 108 | + 'type' => 'hidden', |
| | 109 | + 'default' => $project, |
| | 110 | + ); |
| | 111 | + $keyInfo['project'] = array( |
| | 112 | + 'type' => 'hidden', |
| | 113 | + 'default' => $keyname, |
| | 114 | + ); |
| | 115 | + } else if ( $wgOpenStackManagerNovaKeypairStorage == 'ldap' ) { |
| | 116 | + $hash = $wgRequest->getVal( 'hash' ); |
| | 117 | + $keypairs = $this->userLDAP->getKeypairs(); |
| | 118 | + if ( ! $wgRequest->wasPosted() ) { |
| | 119 | + $out = Html::element( 'pre', array(), $keypairs[$hash] ); |
| | 120 | + $out .= Html::element( 'p', array(), wfMsg( 'openstackmanager-deletekeyconfirm' ) ); |
| | 121 | + $wgOut->addHTML( $out ); |
| | 122 | + } |
| | 123 | + $keyInfo['hash'] = array( |
| | 124 | + 'type' => 'hidden', |
| | 125 | + 'default' => $hash, |
| | 126 | + ); |
| | 127 | + } |
| | 128 | + $keyInfo['key'] = array( |
| | 129 | + 'type' => 'hidden', |
| | 130 | + 'default' => $keypairs[$hash], |
| | 131 | + ); |
| | 132 | + $keyInfo['action'] = array( |
| | 133 | + 'type' => 'hidden', |
| | 134 | + 'default' => 'delete', |
| | 135 | + ); |
| | 136 | + $keyForm = new SpecialNovaKeyForm( $keyInfo, 'openstackmanager-novakey' ); |
| | 137 | + $keyForm->setTitle( SpecialPage::getTitleFor( 'NovaKey' ) ); |
| | 138 | + $keyForm->setSubmitID( 'novakey-form-deletekeysubmit' ); |
| | 139 | + $keyForm->setSubmitCallback( array( $this, 'tryDeleteSubmit' ) ); |
| | 140 | + $keyForm->setSubmitText( 'confirm' ); |
| | 141 | + $keyForm->show(); |
| | 142 | + return true; |
| | 143 | + } |
| | 144 | + |
| | 145 | + function listKeys() { |
| | 146 | + global $wgOut, $wgUser; |
| | 147 | + global $wgOpenStackManagerNovaKeypairStorage; |
| | 148 | + |
| | 149 | + $this->setHeaders(); |
| | 150 | + $wgOut->setPagetitle( wfMsg( 'openstackmanager-keylist' ) ); |
| | 151 | + |
| | 152 | + $out = ''; |
| | 153 | + $sk = $wgUser->getSkin(); |
| | 154 | + if ( $wgOpenStackManagerNovaKeypairStorage == 'nova' ) { |
| | 155 | + $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-importkey' ), array(), array( 'action' => 'import' ), array() ); |
| | 156 | + $projects = $this->userLDAP->getProjects(); |
| | 157 | + foreach ( $projects as $project ) { |
| | 158 | + $userCredentials = $this->userLDAP->getCredentials( $project ); |
| | 159 | + $this->userNova = new OpenStackNovaController( $userCredentials ); |
| | 160 | + $keypairs = $this->userNova->getKeypairs(); |
| | 161 | + if ( ! $keypairs ) { |
| | 162 | + continue; |
| | 163 | + } |
| | 164 | + $out .= Html::element( 'h2', array(), $project ); |
| | 165 | + $projectOut = Html::element( 'th', array(), wfMsg( 'openstackmanager-name' ) ); |
| | 166 | + $projectOut .= Html::element( 'th', array(), wfMsg( 'openstackmanager-fingerprint' ) ); |
| | 167 | + foreach ( $keypairs as $keypair ) { |
| | 168 | + $keyOut = Html::element( 'td', array(), $keypair->getKeyName() ); |
| | 169 | + $keyOut .= Html::element( 'td', array(), $keypair->getKeyFingerprint() ); |
| | 170 | + $projectOut .= Html::rawElement( 'tr', array(), $keyOut ); |
| | 171 | + } |
| | 172 | + $out .= Html::rawElement( 'table', array( 'id' => 'novakeylist', 'class' => 'wikitable' ), $projectOut ); |
| | 173 | + } |
| | 174 | + } else if ( $wgOpenStackManagerNovaKeypairStorage == 'ldap' ) { |
| | 175 | + $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-importkey' ), array(), array( 'action' => 'import' ), array() ); |
| | 176 | + $keypairs = $this->userLDAP->getKeypairs(); |
| | 177 | + $keysOut = ''; |
| | 178 | + foreach ( $keypairs as $hash => $key ) { |
| | 179 | + $keyOut = Html::element( 'td', array(), $key ); |
| | 180 | + $msg = wfMsg( 'openstackmanager-delete' ); |
| | 181 | + $link = $sk->link( $this->getTitle(), $msg, array(), array( 'action' => 'delete', 'hash' => $hash ), array() ); |
| | 182 | + $keyOut .= Html::rawElement( 'td', array(), $link ); |
| | 183 | + $keysOut .= Html::rawElement( 'tr', array(), $keyOut ); |
| | 184 | + } |
| | 185 | + $out .= Html::rawElement( 'table', array(), $keysOut ); |
| | 186 | + } else { |
| | 187 | + $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-invalidkeypair' ) ); |
| | 188 | + } |
| | 189 | + |
| | 190 | + $wgOut->addHTML( $out ); |
| | 191 | + } |
| | 192 | + |
| | 193 | + function tryImportSubmit( $formData, $entryPoint = 'internal' ) { |
| | 194 | + global $wgOut, $wgUser; |
| | 195 | + global $wgOpenStackManagerNovaKeypairStorage; |
| | 196 | + |
| | 197 | + if ( $wgOpenStackManagerNovaKeypairStorage == 'ldap' ) { |
| | 198 | + $success = $this->userLDAP->importKeypair( $formData['key'] ); |
| | 199 | + if ( ! $success ) { |
| | 200 | + $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-keypairimportfailed' ) ); |
| | 201 | + $wgOut->addHTML( $out ); |
| | 202 | + return false; |
| | 203 | + } |
| | 204 | + $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-keypairimported' ) ); |
| | 205 | + } else if ( $wgOpenStackManagerNovaKeypairStorage == 'nova' ) { |
| | 206 | + # wgOpenStackManagerNovaKeypairStorage == 'nova' |
| | 207 | + # OpenStack's EC2 API doesn't yet support importing keys, use |
| | 208 | + # of this option isn't currently recommended |
| | 209 | + $keypair = $this->userNova->importKeypair( $formData['keyname'], $formData['key'] ); |
| | 210 | + |
| | 211 | + $out = Html::element( 'p', array(), wfMsgExt( 'openstackmanager-keypairimportedfingerprint', array(), |
| | 212 | + $keypair->getKeyName(), $keypair->getKeyFingerprint() ) ); |
| | 213 | + } else { |
| | 214 | + $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-invalidkeypair' ) ); |
| | 215 | + } |
| | 216 | + $out .= '<br />'; |
| | 217 | + $sk = $wgUser->getSkin(); |
| | 218 | + $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backkeylist' ), array(), array(), array() ); |
| | 219 | + $wgOut->addHTML( $out ); |
| | 220 | + return true; |
| | 221 | + } |
| | 222 | + |
| | 223 | + function tryDeleteSubmit( $formData, $entryPoint = 'internal' ) { |
| | 224 | + global $wgOut, $wgUser; |
| | 225 | + global $wgOpenStackManagerNovaKeypairStorage; |
| | 226 | + |
| | 227 | + $success = $this->userLDAP->deleteKeypair( $formData['key'] ); |
| | 228 | + if ( $success ) { |
| | 229 | + $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-deletedkey' ) ); |
| | 230 | + } else { |
| | 231 | + $out = Html::element( 'p', array(), wfMsg( 'openstackmanager-deletedkeyfailed' ) ); |
| | 232 | + } |
| | 233 | + $out .= '<br />'; |
| | 234 | + $sk = $wgUser->getSkin(); |
| | 235 | + $out .= $sk->link( $this->getTitle(), wfMsg( 'openstackmanager-backkeylist' ), array(), array(), array() ); |
| | 236 | + $wgOut->addHTML( $out ); |
| | 237 | + return true; |
| | 238 | + } |
| | 239 | +} |
| | 240 | + |
| | 241 | +class SpecialNovaKeyForm extends HTMLForm { |
| | 242 | +} |
| Property changes on: trunk/extensions/OpenStackManager/special/SpecialNovaKey.php |
| ___________________________________________________________________ |
| Added: svn:eol-style |
| 1 | 243 | + native |
| Index: trunk/extensions/OpenStackManager/special/SpecialNova.php |
| — | — | @@ -0,0 +1,27 @@ |
| | 2 | +<?php |
| | 3 | + |
| | 4 | +abstract class SpecialNova extends SpecialPage { |
| | 5 | + function notLoggedIn() { |
| | 6 | + global $wgOut; |
| | 7 | + |
| | 8 | + $this->setHeaders(); |
| | 9 | + $wgOut->setPagetitle( wfMsg( 'openstackmanager-notloggedin' ) ); |
| | 10 | + $wgOut->addHTML( wfMsg( 'openstackmanager-mustbeloggedin' ) ); |
| | 11 | + } |
| | 12 | + |
| | 13 | + function noCredentials() { |
| | 14 | + global $wgOut; |
| | 15 | + |
| | 16 | + $this->setHeaders(); |
| | 17 | + $wgOut->setPagetitle( wfMsg( 'openstackmanager-nonovacred' ) ); |
| | 18 | + $wgOut->addHTML( wfMsg( 'openstackmanager-nonovacred-admincreate' ) ); |
| | 19 | + } |
| | 20 | + |
| | 21 | + function notInProject() { |
| | 22 | + global $wgOut; |
| | 23 | + |
| | 24 | + $this->setHeaders(); |
| | 25 | + $wgOut->setPagetitle( wfMsg( 'openstackmanager-noaccount' ) ); |
| | 26 | + $wgOut->addHTML( wfMsg( 'openstackmanager-noaccount2' ) ); |
| | 27 | + } |
| | 28 | +} |
| Property changes on: trunk/extensions/OpenStackManager/special/SpecialNova.php |
| ___________________________________________________________________ |
| Added: svn:eol-style |
| 1 | 29 | + native |
| Index: trunk/extensions/OpenStackManager/OpenStackManager.php |
| — | — | @@ -63,12 +63,12 @@ |
| 64 | 64 | $wgAutoloadClasses['OpenStackNovaDomain'] = $dir . 'OpenStackNovaDomain.php'; |
| 65 | 65 | $wgAutoloadClasses['OpenStackNovaHost'] = $dir . 'OpenStackNovaHost.php'; |
| 66 | 66 | $wgAutoloadClasses['OpenStackNovaAddress'] = $dir . 'OpenStackNovaAddress.php'; |
| 67 | | -$wgAutoloadClasses['SpecialNovaInstance'] = $dir . 'SpecialNovaInstance.php'; |
| 68 | | -$wgAutoloadClasses['SpecialNovaKey'] = $dir . 'SpecialNovaKey.php'; |
| 69 | | -$wgAutoloadClasses['SpecialNovaProject'] = $dir . 'SpecialNovaProject.php'; |
| 70 | | -$wgAutoloadClasses['SpecialNovaDomain'] = $dir . 'SpecialNovaDomain.php'; |
| 71 | | -$wgAutoloadClasses['SpecialNovaAddress'] = $dir . 'SpecialNovaAddress.php'; |
| 72 | | -$wgAutoloadClasses['SpecialNova'] = $dir . 'SpecialNova.php'; |
| | 67 | +$wgAutoloadClasses['SpecialNovaInstance'] = $dir . 'special/SpecialNovaInstance.php'; |
| | 68 | +$wgAutoloadClasses['SpecialNovaKey'] = $dir . 'special/SpecialNovaKey.php'; |
| | 69 | +$wgAutoloadClasses['SpecialNovaProject'] = $dir . 'special/SpecialNovaProject.php'; |
| | 70 | +$wgAutoloadClasses['SpecialNovaDomain'] = $dir . 'special/SpecialNovaDomain.php'; |
| | 71 | +$wgAutoloadClasses['SpecialNovaAddress'] = $dir . 'special/SpecialNovaAddress.php'; |
| | 72 | +$wgAutoloadClasses['SpecialNova'] = $dir . 'special/SpecialNova.php'; |
| 73 | 73 | $wgAutoloadClasses['OpenStackNovaHostJob'] = $dir . 'OpenStackNovaHostJob.php'; |
| 74 | 74 | $wgAutoloadClasses['AmazonEC2'] = $dir . 'aws-sdk/sdk.class.php'; |
| 75 | 75 | $wgSpecialPages['NovaInstance'] = 'SpecialNovaInstance'; |